Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
SSLPGLEDWEDEFD2.4.1.11;Glycogen(starch) synthase. 10
  • Gene: GYS1
VLFEVAWEVANKVGGIYTVLQTKAKVTGDEWGDNY2.4.1.11;Glycogen(starch) synthase. 28
  • Binding Site K=Lysine at location 39 on the protein
  • Binding site description: UDP-glucose (By similarity).
  • Gene: GYS1
LVGPYTEQGVRTQVELLE2.4.1.11;Glycogen(starch) synthase. 64
  • Gene: GYS1
GRWLIEG2.4.1.11;Glycogen(starch) synthase. 104 -
TTHATLLGR2.4.1.11;Glycogen(starch) synthase. 203 -
VDFYNNL2.4.1.11;Glycogen(starch) synthase. 218 -
DKEAGERQIYHRYCMERA2.4.1.11;Glycogen(starch) synthase. 230 -
HVFTTVS2.4.1.11;Glycogen(starch) synthase. 253 -
TPNGLNVKKFSA2.4.1.11;Glycogen(starch) synthase. 278 -
KFSAMHEFQNLH2.4.1.11;Glycogen(starch) synthase. 286 -
HEFQNLHA2.4.1.11;Glycogen(starch) synthase. 291 -
LDKTLYFF2.4.1.11;Glycogen(starch) synthase. 320 -
AGRYEFSNKG2.4.1.11;Glycogen(starch) synthase. 329 -
TNNFNVETLKGQAVRKQLWD2.4.1.11;Glycogen(starch) synthase. 372 -
TIRRIGLFN2.4.1.11;Glycogen(starch) synthase. 459 -
IFHPEFL2.4.1.11;Glycogen(starch) synthase. 476 -
HPEFLSSTSPLLP2.4.1.11;Glycogen(starch) synthase. 478 -
FPSYYEP2.4.1.11;Glycogen(starch) synthase. 505 -
SYYEPWGYTPAECTVMG2.4.1.11;Glycogen(starch) synthase. 507 -
TNLSGFGC2.4.1.11;Glycogen(starch) synthase. 529 -
QSRRQRII2.4.1.11;Glycogen(starch) synthase. 577 -
RRQRIIQRNRTERLSDLLDW2.4.1.11;Glycogen(starch) synthase. 579 -
SVPPSPS2.4.1.11;Glycogen(starch) synthase. 641 -
EEAAKDRRNIRAPEWPRRASC2.4.1.11;Glycogen(starch) synthase. 679
  • Gene: GYS1
STPSEPLSP2.4.1.11;Glycogen(starch) synthase. 720
  • Gene: GYS1

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MPLNRTLSMSSLPGLEDWEDEFDLENAVLFEVAWEVANKVGGIYTVLQTKAKVTGDEWGDNYFLVGPYTEQGVRTQVELLEAPTPALKRTLDSMNSKGCK
VYF
GRWLIEGGPLVVLLDVGASAWALERWKGELWDTCNIGVPWYDREANDAVLFGFLTTWFLGEFLAQSEEKPHVVAHFHEWLAGVGLCLCRARRLPVAT
IF
TTHATLLGRYLCAGAVDFYNNLENFNVDKEAGERQIYHRYCMERAAAHCAHVFTTVSQITAIEAQHLLKRKPDIVTPNGLNVKKFSAMHEFQNLHAQS
KARIQEFVRGHFYGHLDFN
LDKTLYFFIAGRYEFSNKGADVFLEALARLNYLLRVNGSEQTVVAFFIMPARTNNFNVETLKGQAVRKQLWDTANTVKEKF
GRKLYESLLVGSLPDMNKMLDKEDFTMMKRAIFATQRQSFPPVCTHNMLDDSSDPILT
TIRRIGLFNSSADRVKVIFHPEFLSSTSPLLPVDYEEFVRGC
HLGV
FPSYYEPWGYTPAECTVMGIPSISTNLSGFGCFMEEHIADPSAYGIYILDRRFRSLDDSCSQLTSFLYSFCQQSRRQRIIQRNRTERLSDLLDWKY
LGRYYMSARHMALSKAFPEHFTYEPNEADAAQGYRYPRPA
SVPPSPSLSRHSSPHQSEDEEDPRNGPLEEDGERYDEDEEAAKDRRNIRAPEWPRRASCT
SSTSGSKRNSVDTATSSSL
STPSEPLSPTSSLGEERN



DME EC Prediction for this protein is: 2.4.1.11
Check another protein