Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
KVALVTG1.1.1;With NAD(+) or NADP(+) as acceptor. 6 -
GAKVALVDWNLE1.1.1.141;15-hydroxyprostaglandin dehydrogenase (NAD(+)). 29
  • Gene: PGDH
QCDVADQ1.1.1.141;15-hydroxyprostaglandin dehydrogenase (NAD(+)). 62
  • Gene: PGDH
QLRDTFRKVVDHFG1.1.1.141;15-hydroxyprostaglandin dehydrogenase (NAD(+)). 70
  • Gene: PGDH
LMNSGVR1.1.1.141;15-hydroxyprostaglandin dehydrogenase (NAD(+)). 171
  • Gene: PGDH
SIEKEENMG1.1.1.141;15-hydroxyprostaglandin dehydrogenase (NAD(+)). 193
  • Gene: PGDH
LIEDDALNGAIMKIT1.1.1.141;15-hydroxyprostaglandin dehydrogenase (NAD(+)). 232
  • Gene: PGDH

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MHVNGKVALVTGAAQGIGRAFAEALLLKGAKVALVDWNLEAGVQCKAALDEQFEPQKTLFIQCDVADQQQLRDTFRKVVDHFGRLDILVNNAGVNNEKNW
EKTLQINLVSVISGTYLGLDYMSKQNGGEGGIIINMSSLAGLMPVAQQPVYCASKHGIVGFTRSAALAAN
LMNSGVRLNAICPGFVNTAILESIEKEENM
G
QYIEYKDHIKDMIKYYGILDPPLIANGLITLIEDDALNGAIMKITTSKGIHFQDYDTTPFQAKTQ



DME EC Prediction for this protein is: 1.1.1.141
Check another protein