Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
RGHKCGVFLLNGP1.14.15.4;Steroid 11-beta-monooxygenase. 123
  • Gene: C11B1
GVFLLNGPEW1.14.15.4;Steroid 11-beta-monooxygenase. 128
  • Gene: C11B1
AGSVDTT1.14.15;With a reduced iron-sulfur protein as one donor 313 -
VQQALRQES1.14.15.4;Steroid 11-beta-monooxygenase. 336
  • Gene: C11B1
LPLLRAALKETLRLYPVG1.14.15.4;Steroid 11-beta-monooxygenase. 362
  • Gene: C11B1
IPAGTLV1.14.15;With a reduced iron-sulfur protein as one donor 397 -
LYSLGRNPA1.14.15.4;Steroid 11-beta-monooxygenase. 407
  • Gene: C11B1
RQCLGRR1.14.15;With a reduced iron-sulfur protein as one donor 448
  • Metal Site C=Cysteine at location 450 on the protein
  • Metal Site Description: Iron (heme axial ligand) (By s

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MALRAKAEVCMAVPWLSLQRAQALGTRAARVPRTVLPFEAMPRRPGNRWLRLLQIWREQGYEDLHLEVHQTFQELGPIFRYDLGGAGMVCVMLPEDVEKL
QQVDSLHPHRMSLEPWVAYRQH
RGHKCGVFLLNGPEWRFNRLRLNPEVLSPNAVQRFLPMVDAVARDFSQALKKKVLQNARGSLTLDVQPSIFHYTIEAS
NLALFGERLGLVGHSPSSASLNFLHALEVMFKSTVQLMFMPRSLSRWTSPKVWKEHFEAWDCIFQYGDNCIQKIYQELAFSRPQQYTSIVAELLLNAELS
PDAIKANSMELT
AGSVDTTVFPLLMTLFELARNPNVQQALRQESLAAAASISEHPQKATTELPLLRAALKETLRLYPVGLFLERVASSDLVLQNYHIPAG
TLV
RVFLYSLGRNPALFPRPERYNPQRWLDIRGSGRNFYHVPFGFGMRQCLGRRLAEAEMLLLLHHVLKHLQVETLTQEDIKMVYSFILRPSMFPLLTFR
AIN



DME EC Prediction for this protein is: 1.14.15.4
Check another protein