Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
GRGVSSVVRRC2.7.11.19;Phosphorylase kinase. 31
  • Domain: Protein kinase
FLVFDLM2.7.11.19;Phosphorylase kinase. 104
  • Domain: Protein kinase
GELFDYLTEKV2.7.11.19;Phosphorylase kinase. 113
  • Domain: Protein kinase
LSEKETR2.7.11.19;Phosphorylase kinase. 125
  • Domain: Protein kinase
NIVHRDLKPENILLDD2.7.11.19;Phosphorylase kinase. 148
  • Active Site D=Aspartic acid at location 153 on the protein
  • Active Site Description: Proton acceptor (By similarity
  • Domain: Protein kinase
IVHRDLK2.7.11;Protein-serine/threonine kinases. 149
  • Active Site R=Arginine at location 152 on the protein
  • Active Site Description: Proton acceptor (By similarity
  • Domain: Protein kinase
VHRDLKP2.7.11;Protein-serine/threonine kinases. 150
  • Active Site R=Arginine at location 152 on the protein
  • Active Site Description: Proton acceptor (By similarity
  • Domain: Protein kinase
RDLKPEN2.7.11;Protein-serine/threonine kinases. 152
  • Active Site D=Aspartic acid at location 153 on the protein
  • Active Site Description: Proton acceptor (By similarity
  • Domain: Protein kinase
KPENILLD2.7.11;Protein-serine/threonine kinases. 155
  • Domain: Protein kinase
HPGYGKEVD2.7.11.19;Phosphorylase kinase. 207
  • Domain: Protein kinase
GYGKEVD2.7.11;Protein-serine/threonine kinases. 209
  • Domain: Protein kinase
WACGVIL2.7.11;Protein-serine/threonine kinases. 217
  • Domain: Protein kinase
TLLAGSPPFWHR2.7.11.19;Phosphorylase kinase. 225
  • Domain: Protein kinase
RLTAEQALQ2.7.11;Protein-serine/threonine kinases. 279
  • Domain: Protein kinase
RDPYALR2.7.11.19;Phosphorylase kinase. 338 -
YGHWVKKG2.7.11.19;Phosphorylase kinase. 358 -
QQNRAALF2.7.11.19;Phosphorylase kinase. 367 -

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MTLDVGPEDELPDWAAAKEFYQKYDPKDVIGRGVSSVVRRCVHRATGHEFAVKIMEVTAERLSPEQLEEVREATRRETHILRQVAGHPHIITLIDSYESS
SFM
FLVFDLMRKGELFDYLTEKVALSEKETRSIMRSLLEAVSFLHANNIVHRDLKPENILLDDNMQIRLSDFGFSCHLEPGEKLRELCGTPGYLAPEILK
CSMDET
HPGYGKEVDLWACGVILFTLLAGSPPFWHRRQILMLRMIMEGQYQFSSPEWDDRSSTVKDLISRLLQVDPEARLTAEQALQHPFFERCEGSQPW
NLTPRQRFRVAVWTVLAAGRVALSTHRVRPLTKNALL
RDPYALRSVRHLIDNCAFRLYGHWVKKGEQQNRAALFQHRPPGPFPIMGPEEEGDSAAITEDE
AVLVLG



DME EC Prediction for this protein is: 2.7.11.19
Check another protein