Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
CYYNHTQ2.7.10.1;Receptor protein-tyrosine kinase. 100
  • Domain: Ig-like C2-type
  • Gene: PGFRA
IYIYVPDP2.7.10.1;Receptor protein-tyrosine kinase. 117
  • Domain: Ig-like C2-type
  • Gene: PGFRA
GETIVVTC2.7.10.1;Receptor protein-tyrosine kinase. 228
  • Domain: Ig-like C2-type
  • Gene: PGFRA
TLIENLTEI2.7.10.1;Receptor protein-tyrosine kinase. 355
  • Domain: Ig-like C2-type
  • Gene: PGFRA
ENLTEITT2.7.10.1;Receptor protein-tyrosine kinase. 358
  • Domain: Ig-like C2-type
  • Gene: PGFRA
LIRAKEEDSG2.7.10.1;Receptor protein-tyrosine kinase. 381
  • Domain: Ig-like C2-type
  • Gene: PGFRA
ELTVAAAVLVLLVIVIISLIVLV2.7.10.1;Receptor protein-tyrosine kinase. 524
  • Gene: PGFRA
KPRYEIRW2.7.10.1;Receptor protein-tyrosine kinase. 552 -
DGHEYIYVDP2.7.10.1;Receptor protein-tyrosine kinase. 568 -
VAVKMLK2.7.10.1;Receptor protein-tyrosine kinase. 624
  • Binding Site K=Lysine at location 627 on the protein
  • Binding site description: ATP (By similarity).
  • Domain: Protein kinase
ALMSELK2.7.10.1;Receptor protein-tyrosine kinase. 640
  • Domain: Protein kinase
NIVNLLGACT2.7.10.1;Receptor protein-tyrosine kinase. 656
  • Domain: Protein kinase
GPIYIITEYC2.7.10.1;Receptor protein-tyrosine kinase. 668
  • Domain: Protein kinase
PIYIITE2.7.10;Protein-tyrosine kinases. 669
  • Domain: Protein kinase
RSYVILS2.7.10.1;Receptor protein-tyrosine kinase. 718
  • Domain: Protein kinase
  • Gene: PGFRA
QYVPMLE2.7.10.1;Receptor protein-tyrosine kinase. 741
  • Domain: Protein kinase
  • Gene: PGFRA
SKYSDIQRS2.7.10.1;Receptor protein-tyrosine kinase. 752
  • Domain: Protein kinase
  • Gene: PGFRA
DLLSFTYQVA2.7.10.1;Receptor protein-tyrosine kinase. 794
  • Domain: Protein kinase
  • Gene: PGFRA
QVARGME2.7.10.1;Receptor protein-tyrosine kinase. 801
  • Domain: Protein kinase
FLASKNCVHRDLAARNVL2.7.10.1;Receptor protein-tyrosine kinase. 808
  • Active Site D=Aspartic acid at location 818 on the protein
  • Active Site Description: Proton acceptor (By similarity
  • Domain: Protein kinase
RDLAARN2.7.10;Protein-tyrosine kinases. 817
  • Active Site D=Aspartic acid at location 818 on the protein
  • Active Site Description: Proton acceptor (By similarity
  • Domain: Protein kinase
AARNVLL2.7.10;Protein-tyrosine kinases. 820
  • Domain: Protein kinase
KICDFGLARD2.7.10.1;Receptor protein-tyrosine kinase. 833
  • Domain: Protein kinase
DFGLARDI2.7.10.1;Receptor protein-tyrosine kinase. 836
  • Domain: Protein kinase
LPVKWMA2.7.10.1;Receptor protein-tyrosine kinase. 857
  • Domain: Protein kinase
PVKWMAPE2.7.10.1;Receptor protein-tyrosine kinase. 858
  • Domain: Protein kinase
KWMAPESIF2.7.10.1;Receptor protein-tyrosine kinase. 860
  • Domain: Protein kinase
LYTTLSDVWS2.7.10.1;Receptor protein-tyrosine kinase. 871
  • Domain: Protein kinase
SDVWSYGI2.7.10;Protein-tyrosine kinases. 876
  • Domain: Protein kinase
GILLWEIF2.7.10.1;Receptor protein-tyrosine kinase. 882
  • Domain: Protein kinase
WEIFSLG2.7.10.1;Receptor protein-tyrosine kinase. 886
  • Domain: Protein kinase
LGGTPYP2.7.10.1;Receptor protein-tyrosine kinase. 891
  • Domain: Protein kinase
FYNKIKSGYRM2.7.10.1;Receptor protein-tyrosine kinase. 905
  • Domain: Protein kinase
  • Gene: PGFRA
EPEKRPSFYHLSEIVE2.7.10.1;Receptor protein-tyrosine kinase. 936
  • Domain: Protein kinase
  • Gene: PGFRA
FLKSDHPAV2.7.10.1;Receptor protein-tyrosine kinase. 969 -
YIGVTYKNE2.7.10.1;Receptor protein-tyrosine kinase. 988
  • Gene: PGFRA
DEQRLSADSGYI2.7.10.1;Receptor protein-tyrosine kinase. 1008
  • Gene: PGFRA
PLPDIDPV2.7.10.1;Receptor protein-tyrosine kinase. 1021
  • Gene: PGFRA
KRNRHSSQTSEESAI2.7.10.1;Receptor protein-tyrosine kinase. 1036
  • Gene: PGFRA

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MGTSHPAFLVLGCLLTGLSLILCQLSLPSILPNENEKVVQLNSSFSLRCFGESEVSWQYPMSEEESSDVEIRNEENNSGLFVTVLEVSSASAAHTGLYTC
YYNHTQ
TEENELEGRHIYIYVPDPDVAFVPLGMTDYLVIVEDDDSAIIPCRTTDPETPVTLHNSEGVVPASYDSRQGFNGTFTVGPYICEATVKGKKFQT
IPFNVYALKATSELDLEMEALKTVYKS
GETIVVTCAVFNNEVVDLQWTYPGEVKGKGITMLEEIKVPSIKLVYTLTVPEATVKDSGDYECAARQATREVK
EMKKVTISVHEKGFIEIKPTFSQLEAVNLHEVKHFVVEVRAYPPPRISWLKNNL
TLIENLTEITTDVEKIQEIRYRSKLKLIRAKEEDSGHYTIVAQNED
AVKSYTFELLTQVPSSILDLVDDHHGSTGGQTVRCTAEGTPLPDIEWMICKDIKKCNNETSWTILANNVSNIITEIHSRDRSTVEGRVTFAKVEETIAVR
CLAKNLLGAENRELKLVAPTLRS
ELTVAAAVLVLLVIVIISLIVLVVIWKQKPRYEIRWRVIESISPDGHEYIYVDPMQLPYDSRWEFPRDGLVLGRVLG
SGAFGKVVEGTAYGLSRSQPVMK
VAVKMLKPTARSSEKQALMSELKIMTHLGPHLNIVNLLGACTKSGPIYIITEYCFYGDLVNYLHKNRDSFLSHHPEK
PKKELDIFGLNPADEST
RSYVILSFENNGDYMDMKQADTTQYVPMLERKEVSKYSDIQRSLYDRPASYKKKSMLDSEVKNLLSDDNSEGLTLLDLLSFTY
QVARGMEFLASKNCVHRDLAARNVLL
AQGKIVKICDFGLARDIMHDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGILLWEIFSLGGTPYPGMM
VDST
FYNKIKSGYRMAKPDHATSEVYEIMVKCWNSEPEKRPSFYHLSEIVENLLPGQYKKSYEKIHLDFLKSDHPAVARMRVDSDNAYIGVTYKNEEDKL
KDWEGGL
DEQRLSADSGYIIPLPDIDPVPEEEDLGKRNRHSSQTSEESAIETGSSSSTFIKREDETIEDIDMMDDIGIDSSDLVEDSFL



DME EC Prediction for this protein is: 2.7.10.1
Check another protein