Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
VAEEVSLFS1.6.2.4;NADPH--hemoprotein reductase. 16
  • Gene: NCPR
EKMKKTGRNI1.6.2.4;NADPH--hemoprotein reductase. 71
  • Gene: NCPR
GSQTGTA1.6.2.4;NADPH--hemoprotein reductase. 85
  • Domain: Flavodoxin-like
EEFANRLSKDAHRYGM1.6.2.4;NADPH--hemoprotein reductase. 92
  • Domain: Flavodoxin-like
  • Gene: NCPR
GEGDPTDNA1.6.2.4;NADPH--hemoprotein reductase. 141
  • Domain: Flavodoxin-like
RLEQLGAQRIF1.6.2.4;NADPH--hemoprotein reductase. 191
  • Domain: Flavodoxin-like
  • Gene: NCPR
GDDDGNLEEDF1.6.2.4;NADPH--hemoprotein reductase. 206
  • Domain: Flavodoxin-like
  • Gene: NCPR
TWREQFWPA1.6.2.4;NADPH--hemoprotein reductase. 218
  • Domain: Flavodoxin-like
  • Gene: NCPR
PPFDAKNPFLA1.6.2.4;NADPH--hemoprotein reductase. 274
  • Gene: NCPR
SKIRYESGDHVAVYP1.6.2.4;NADPH--hemoprotein reductase. 310
  • Domain: FAD-binding FR-type
  • Gene: NCPR
PPRTNVLYELAQYA1.6.2.4;NADPH--hemoprotein reductase. 380
  • Domain: FAD-binding FR-type
  • Gene: NCPR
KMASSSGEGKELYL1.6.2.4;NADPH--hemoprotein reductase. 404
  • Domain: FAD-binding FR-type
  • Gene: NCPR
CELLPRLQ1.6.2.4;NADPH--hemoprotein reductase. 445
  • Domain: FAD-binding FR-type
  • Gene: NCPR
PRLQARYYSIASSSKVHPNS1.6.2.4;NADPH--hemoprotein reductase. 449
  • Domain: FAD-binding FR-type
  • Gene: NCPR
KEPAGENG1.6.2.4;NADPH--hemoprotein reductase. 497
  • Domain: FAD-binding FR-type
  • Gene: NCPR
RKSQFRLP1.6.2.4;NADPH--hemoprotein reductase. 514
  • Domain: FAD-binding FR-type
  • Gene: NCPR
GKEVGET1.6.2.4;NADPH--hemoprotein reductase. 554
  • Gene: NCPR
EDYLYREELA1.6.2.4;NADPH--hemoprotein reductase. 571
  • Gene: NCPR
DVQNTFYDIVAE1.6.2.4;NADPH--hemoprotein reductase. 638
  • Gene: NCPR
KKLMTKGRYS1.6.2.4;NADPH--hemoprotein reductase. 663
  • Gene: NCPR

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MGDSHVDTSSTVSEAVAEEVSLFSMTDMILFSLIVGLLTYWFLFRKKKEEVPEFTKIQTLTSSVRESSFVEKMKKTGRNIIVFYGSQTGTAEEFANRLSK
DAHRYGM
RGMSADPEEYDLADLSSLPEIDNALVVFCMATYGEGDPTDNAQDFYDWLQETDVDLSGVKFAVFGLGNKTYEHFNAMGKYVDKRLEQLGAQRI
F
ELGLGDDDGNLEEDFITWREQFWPAVCEHFGVEATGEESSIRQYELVVHTDIDAAKVYMGEMGRLKSYENQKPPFDAKNPFLAAVTTNRKLNQGTERHL
MHLELDISD
SKIRYESGDHVAVYPANDSALVNQLGKILGADLDVVMSLNNLDEESNKKHPFPCPTSYRTALTYYLDITNPPRTNVLYELAQYASEPSEQE
LLR
KMASSSGEGKELYLSWVVEARRHILAILQDCPSLRPPIDHLCELLPRLQARYYSIASSSKVHPNSVHICAVVVEYETKAGRINKGVATNWLRAKEPA
GENG
GRALVPMFVRKSQFRLPFKATTPVIMVGPGTGVAPFIGFIQERAWLRQQGKEVGETLLYYGCRRSDEDYLYREELAQFHRDGALTQLNVAFSREQS
HKVYVQHLLKQDREHLWKLIEGGAHIYVCGDARNMAR
DVQNTFYDIVAELGAMEHAQAVDYIKKLMTKGRYSLDVWS



DME EC Prediction for this protein is: 1.6.2.4
Check another protein