Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
ESVKEFLAKAKE2.7.11.11;cAMP-dependent protein kinase. 14 -
TLGTGSFGRV2.7.11.11;cAMP-dependent protein kinase. 49
  • Domain: Protein kinase
EHTLNEKRILQA2.7.11.11;cAMP-dependent protein kinase. 87
  • Domain: Protein kinase
GRFSEPHA2.7.11.11;cAMP-dependent protein kinase. 137
  • Domain: Protein kinase
YLHSLDLI2.7.11.11;cAMP-dependent protein kinase. 157
  • Domain: Protein kinase
RDLKPEN2.7.11;Protein-serine/threonine kinases. 166
  • Active Site D=Aspartic acid at location 167 on the protein
  • Active Site Description: Proton acceptor (By similarity
  • Domain: Protein kinase
RDLKPENLLIDQQGY2.7.11.11;cAMP-dependent protein kinase. 166
  • Active Site D=Aspartic acid at location 167 on the protein
  • Active Site Description: Proton acceptor (By similarity
  • Domain: Protein kinase
LKPENLL2.7.11;Protein-serine/threonine kinases. 168
  • Domain: Protein kinase
TDFGFAK2.7.11;Protein-serine/threonine kinases. 184
  • Domain: Protein kinase
GTPEYLAPE2.7.11;Protein-serine/threonine kinases. 201
  • Domain: Protein kinase
YLAPEII2.7.11;Protein-serine/threonine kinases. 205
  • Domain: Protein kinase
VDWWALGVL2.7.11;Protein-serine/threonine kinases. 220
  • Domain: Protein kinase
LGVLIYEM2.7.11;Protein-serine/threonine kinases. 225
  • Domain: Protein kinase
ADQPIQIYEKIVSG2.7.11.11;cAMP-dependent protein kinase. 241
  • Domain: Protein kinase
SDLKDLLRNLLQVDLTKR2.7.11.11;cAMP-dependent protein kinase. 264
  • Domain: Protein kinase
GVNDIKN2.7.11.11;cAMP-dependent protein kinase. 288
  • Domain: Protein kinase
DIKNHKWF2.7.11.11;cAMP-dependent protein kinase. 291
  • Domain: Protein kinase
HKWFATTDWIAIYQRKVEAPFIPKF2.7.11.11;cAMP-dependent protein kinase. 295
  • Domain: Protein kinase
GDTSNFDDYEEE2.7.11.11;cAMP-dependent protein kinase. 323
  • Domain: AGC-kinase C-termina
EKCGKEF2.7.11.11;cAMP-dependent protein kinase. 342
  • Domain: AGC-kinase C-termina

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MGNAAAAKKGSEQESVKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTGSFGRVMLVKHKETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVN
FPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRI
GRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWTLC
GTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFAT
TDWIAIYQRKVEAPFIPKF
KGPGDTSNFDDYEEEEIRVSINEKCGKEFSEF



DME EC Prediction for this protein is: 2.7.11.11
Check another protein