Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
KIDKYLYAMRLSDE2.7.1.1;Hexokinase. 21
  • Gene: HXK1
MRLSDETL2.7.1.1;Hexokinase. 29 -
VKMLPTFVR2.7.1.1;Hexokinase. 61 -
VRSIPDG2.7.1.1;Hexokinase. 68
  • Gene: HXK1
YDTPENIVHGSG2.7.1.1;Hexokinase. 112
  • Gene: HXK1
HGSGSQLFDHV2.7.1.1;Hexokinase. 120
  • Gene: HXK1
CLGDFMEK2.7.1.1;Hexokinase. 133
  • Gene: HXK1
IKDKKLP2.7.1.1;Hexokinase. 143 -
GFTFSFP2.7.1;Phosphotransferases with an alcohol group as acceptor. 151 -
GFTFSFPC2.7.1.1;Hexokinase. 151 -
KAIKKRGDYDANIVAVVNDTVGTM2.7.1.1;Hexokinase. 191
  • Gene: HXK1
VNDTVGTMM2.7.1.1;Hexokinase. 207 -
TMMTCGY2.7.1.1;Hexokinase. 213 -
VGLIIGTG2.7.1.1;Hexokinase. 226 -
NACYMEE2.7.1;Phosphotransferases with an alcohol group as acceptor. 235 -
IDLVEGDEGRMCINTEWGAFGDDG2.7.1.1;Hexokinase. 245 -
EWGAFGD2.7.1;Phosphotransferases with an alcohol group as acceptor. 260 -
GDDGSLEDIR2.7.1.1;Hexokinase. 265
  • Gene: HXK1
DIRTEFD2.7.1.1;Hexokinase. 272 -
SLNPGKQ2.7.1.1;Hexokinase. 285 -
GELVRLIL2.7.1.1;Hexokinase. 303 -
LLFEGRITPELLTRGKF2.7.1.1;Hexokinase. 318
  • Gene: HXK1
DCVSVQH2.7.1.1;Hexokinase. 367
  • Gene: HXK1
TPRLRTTV2.7.1.1;Hexokinase. 403
  • Gene: HXK1
LYKTHPQY2.7.1.1;Hexokinase. 416 -
HKTLRRLVPD2.7.1.1;Hexokinase. 428 -
AMVTAVA2.7.1.1;Hexokinase. 454 -
ALDLGGTN2.7.1.1;Hexokinase. 530 -
LDLGGTNFRV2.7.1;Phosphotransferases with an alcohol group as acceptor. 531 -
VEMHNKIY2.7.1.1;Hexokinase. 553
  • Binding Site K=Lysine at location 558 on the protein
  • Binding site description: ATP (Potential).
GFTFSFP2.7.1;Phosphotransferases with an alcohol group as acceptor. 599 -
GFTFSFPC2.7.1.1;Hexokinase. 599 -
LLRDAIKRR2.7.1;Phosphotransferases with an alcohol group as acceptor. 636 -
VNDTVGTMM2.7.1.1;Hexokinase. 655 -
GLIVGTG2.7.1.1;Hexokinase. 675 -
NACYMEE2.7.1;Phosphotransferases with an alcohol group as acceptor. 683 -
MCINMEWGAFGD2.7.1.1;Hexokinase. 703 -
NMEWGAFGDNGC2.7.1.1;Hexokinase. 706 -
EWGAFGD2.7.1;Phosphotransferases with an alcohol group as acceptor. 708 -
SGMYLGEI2.7.1.1;Hexokinase. 746 -
YLGEIVRNILIDFTK2.7.1.1;Hexokinase. 749 -
LFRGQISE2.7.1.1;Hexokinase. 767 -
TRGIFETKFLSQIESD2.7.1.1;Hexokinase. 778 -
RAAQLCGAG2.7.1.1;Hexokinase. 829 -
CGAGMAA2.7.1.1;Hexokinase. 834 -
VGVDGTLYKLHP2.7.1.1;Hexokinase. 858 -
DGSGKGAA2.7.1.1;Hexokinase. 895 -

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MIAAQLLAYYFTELKDDQVKKIDKYLYAMRLSDETLIDIMTRFRKEMKNGLSRDFNPTATVKMLPTFVRSIPDGSEKGDFIALDLGGSSFRILRVQVNHE
KNQNVHMESEV
YDTPENIVHGSGSQLFDHVAECLGDFMEKRKIKDKKLPVGFTFSFPCQQSKIDEAILITWTKRFKASGVEGADVVKLLNKAIKKRGDYD
ANIVAVVNDTVGTMMTCGY
DDQHCEVGLIIGTGTNACYMEELRHIDLVEGDEGRMCINTEWGAFGDDGSLEDIRTEFDREIDRGSLNPGKQLFEKMVSGM
YL
GELVRLILVKMAKEGLLFEGRITPELLTRGKFNTSDVSAIEKNKEGLHNAKEILTRLGVEPSDDDCVSVQHVCTIVSFRSANLVAATLGAILNRLRDN
KG
TPRLRTTVGVDGSLYKTHPQYSRRFHKTLRRLVPDSDVRFLLSESGSGKGAAMVTAVAYRLAEQHRQIEETLAHFHLTKDMLLEVKKRMRAEMELGLR
KQTHNNAVVKMLPSFVRRTPDGTENGDFL
ALDLGGTNFRVLLVKIRSGKKRTVEMHNKIYAIPIEIMQGTGEELFDHIVSCISDFLDYMGIKGPRMPLGF
TFSFPC
QQTSLDAGILITWTKGFKATDCVGHDVVTLLRDAIKRREEFDLDVVAVVNDTVGTMMTCAYEEPTCEVGLIVGTGSNACYMEEMKNVEMVEGDQ
GQ
MCINMEWGAFGDNGCLDDIRTHYDRLVDEYSLNAGKQRYEKMISGMYLGEIVRNILIDFTKKGFLFRGQISETLKTRGIFETKFLSQIESDRLALLQV
RAILQQLGLNSTCDDSILVKTVCGVVSR
RAAQLCGAGMAAVVDKIRENRGLDRLNVTVGVDGTLYKLHPHFSRIMHQTVKELSPKCNVSFLLSEDGSGKG
AA
LITAVGVRLRTEASS



DME EC Prediction for this protein is: 2.7.1.1
Check another protein