Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
KRHYEDEE3.6.1;In phosphorous-containing anhydrides. 16
  • Gene: ERCC3
QEAVPSAAGKQV3.6.1;In phosphorous-containing anhydrides. 35
  • Gene: ERCC3
SRPLWVAPDGHIFLEAFSPVYKYAQDFLVAI3.6.1;In phosphorous-containing anhydrides. 73
  • Gene: ERCC3
HEYKLTAYSLYAAVSVGLQT3.6.1;In phosphorous-containing anhydrides. 114
  • Gene: ERCC3
KLSKTGVP3.6.1;In phosphorous-containing anhydrides. 142
  • Gene: ERCC3
CTVSYGKVKLVLK3.6.1;In phosphorous-containing anhydrides. 159
  • Gene: ERCC3
TELITET3.6.1;In phosphorous-containing anhydrides. 207
  • Gene: ERCC3
EEEEEETQTVSFE3.6.1;In phosphorous-containing anhydrides. 259
  • Gene: ERCC3
QEMIEELQKRCI3.6.1;In phosphorous-containing anhydrides. 274
  • Gene: ERCC3
EYDFRND3.6.1;In phosphorous-containing anhydrides. 294 -
NPDINIDLKP3.6.1;In phosphorous-containing anhydrides. 303
  • Gene: ERCC3
RPYQEKSL3.6.1;In phosphorous-containing anhydrides. 317 -
KMFGNGRARSG3.6.1;In phosphorous-containing anhydrides. 326 -
IVLPCGAGK3.6.1;In phosphorous-containing anhydrides. 338
  • Domain: Helicase ATP-binding
VSVEQWK3.6.1;In phosphorous-containing anhydrides. 369
  • Domain: Helicase ATP-binding
  • Gene: ERCC3
QFKMWST3.6.1;In phosphorous-containing anhydrides. 377
  • Domain: Helicase ATP-binding
  • Gene: ERCC3
QICRFTSD3.6.1;In phosphorous-containing anhydrides. 388
  • Domain: Helicase ATP-binding
DLNFLIGPK3.6.1;In phosphorous-containing anhydrides. 479
  • Domain: Helicase ATP-binding
VQCAEVWCPMSPEFYREY3.6.1;In phosphorous-containing anhydrides. 505
  • Gene: ERCC3
MNPNKFRAC3.6.1;In phosphorous-containing anhydrides. 536 -
DKIIVFADN3.6.1;In phosphorous-containing anhydrides. 556
  • Domain: Helicase C-terminal
KPYIYGPT3.6.1;In phosphorous-containing anhydrides. 577
  • Domain: Helicase C-terminal
  • Gene: ERCC3
TIFISKVGDTS3.6.1;In phosphorous-containing anhydrides. 604
  • Domain: Helicase C-terminal
  • Gene: ERCC3
GSRRQEAQRLGR3.6.1;In phosphorous-containing anhydrides. 631
  • Domain: Helicase C-terminal
NAFFYSLVS3.6.1;In phosphorous-containing anhydrides. 656
  • Domain: Helicase C-terminal
DQGYSFKVI3.6.1;In phosphorous-containing anhydrides. 682
  • Domain: Helicase C-terminal
DLDAEEEVV3.6.1;In phosphorous-containing anhydrides. 721
  • Gene: ERCC3
GTMSSMSGADD3.6.1;In phosphorous-containing anhydrides. 745
  • Gene: ERCC3
SGADDTVYMEYHSSR3.6.1;In phosphorous-containing anhydrides. 751
  • Gene: ERCC3

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MGKRDRADRDKKKSRKRHYEDEEDDEEDAPGNDPQEAVPSAAGKQVDESGTKVDEYGAKDYRLQMPLKDDHTSRPLWVAPDGHIFLEAFSPVYKYAQDFL
VAI
AEPVCRPTHVHEYKLTAYSLYAAVSVGLQTSDITEYLRKLSKTGVPDGIMQFIKLCTVSYGKVKLVLKHNRYFVESCHPDVIQHLLQDPVIRECRLR
NSEGEA
TELITETFTSKSAISKTAESSGGPSTSRVTDPQGKSDIPMDLFDFYEQMDKDEEEEEETQTVSFEVKQEMIEELQKRCIHLEYPLLAEYDFRND
SVNPDINIDLKPTAVLRPYQEKSLRKMFGNGRARSGVIVLPCGAGKSLVGVTAACTVRKRCLVLGNSAVSVEQWKAQFKMWSTIDDSQICRFTSDAKDKP
IGCSVAISTYSMLGHTTKRSWEAERVMEWLKTQEWGLMILDEVHTIPAKMFRRVLTIVQAHCKLGLTATLVREDDKIV
DLNFLIGPKLYEANWMELQNNG
YIAK
VQCAEVWCPMSPEFYREYVAIKTKKRILLYTMNPNKFRACQFLIKFHERRNDKIIVFADNVFALKEYAIRLNKPYIYGPTSQGERMQILQNFKHNP
KIN
TIFISKVGDTSFDLPEANVLIQISSHGGSRRQEAQRLGRVLRAKKGMVAEEYNAFFYSLVSQDTQEMAYSTKRQRFLVDQGYSFKVITKLAGMEEED
LAFSTKEEQQQLLQKVLAAT
DLDAEEEVVAGEFGSRSSQASRRFGTMSSMSGADDTVYMEYHSSRSKAPSKHVHPLFKRFRK



DME EC Prediction for this protein is: 3.6.1
Check another protein