Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
VIGGGISGLSAAKLL1.4.3.4;Monoamine oxidase. 18 -
VLEARDRVGGRT1.4.3;With oxygen as acceptor. 41 -
RVGGRTYT1.4.3.4;Monoamine oxidase. 47 -
GPTQNRILR1.4.3.4;Monoamine oxidase. 71 -
FPPVWNP1.4.3.4;Monoamine oxidase. 112 -
DYNNLWR1.4.3.4;Monoamine oxidase. 123 -
DNMGKEIP1.4.3.4;Monoamine oxidase. 132
  • Gene: AOFA
LFVNINVTSEPH1.4.3.4;Monoamine oxidase. 176
  • Gene: AOFA
HEVSALWFLWYV1.4.3.4;Monoamine oxidase. 187 -
VSALWFLWYVKQCGGTTRI1.4.3.4;Monoamine oxidase. 189 -
AIPPTLTAKIHFRPELP1.4.3.4;Monoamine oxidase. 272
  • Gene: AOFA
ERNQLIQRLPMGA1.4.3.4;Monoamine oxidase. 290
  • Gene: AOFA
PAIMGFILARK1.4.3.4;Monoamine oxidase. 347 -
CELYAKVLGS1.4.3.4;Monoamine oxidase. 374 -
PVHYEEKNWC1.4.3.4;Monoamine oxidase. 389 -
RQPVGRI1.4.3.4;Monoamine oxidase. 424 -
PVGRIFFAG1.4.3;With oxygen as acceptor. 426 -
FAGTETAT1.4.3.4;Monoamine oxidase. 432 -
WSGYMEGAV1.4.3.4;Monoamine oxidase. 441 -
AGERAARE1.4.3.4;Monoamine oxidase. 451 -
EPESKDVPA1.4.3.4;Monoamine oxidase. 475
  • Gene: AOFA
ERNLPSV1.4.3.4;Monoamine oxidase. 492 -

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MENQEKASIAGHMFDVVVIGGGISGLSAAKLLTEYGVSVLVLEARDRVGGRTYTIRNEHVDYVDVGGAYVGPTQNRILRLSKELGIETYKVNVSERLVQY
VKGKTYPFRGA
FPPVWNPIAYLDYNNLWRTIDNMGKEIPTDAPWEAQHADKWDKMTMKELIDKICWTKTARRFAYLFVNINVTSEPHEVSALWFLWYVKQ
CGGTTRI
FSVTNGGQERKFVGGSGQVSERIMDLLGDQVKLNHPVTHVDQSSDNIIIETLNHEHYECKYVINAIPPTLTAKIHFRPELPAERNQLIQRLPM
GA
VIKCMMYYKEAFWKKKDYCGCMIIEDEDAPISITLDDTKPDGSLPAIMGFILARKADRLAKLHKEIRKKKICELYAKVLGSQEALHPVHYEEKNWCEE
QYSGGCYTAYFPPGIMTQYGRVI
RQPVGRIFFAGTETATKWSGYMEGAVEAGERAAREVLNGLGKVTEKDIWVQEPESKDVPAVEITHTFWERNLPSVSG
LLKIIGFSTSVTALGFVLYKYKLLPRS



DME EC Prediction for this protein is: 1.4.3.4
Check another protein