Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
PEEPPTK2.7.10.1;Receptor protein-tyrosine kinase. 35
  • Domain: Ig-like C2-type
  • Gene: FGFR2
DSGLYAC2.7.10.1;Receptor protein-tyrosine kinase. 101
  • Domain: Ig-like C2-type
SSGDDED2.7.10.1;Receptor protein-tyrosine kinase. 129 -
AVPAANT2.7.10.1;Receptor protein-tyrosine kinase. 168
  • Domain: Ig-like C2-type
WLKNGKEF2.7.10.1;Receptor protein-tyrosine kinase. 191
  • Domain: Ig-like C2-type
MESVVPSD2.7.10.1;Receptor protein-tyrosine kinase. 218
  • Domain: Ig-like C2-type
SVVPSDKG2.7.10.1;Receptor protein-tyrosine kinase. 220
  • Domain: Ig-like C2-type
GSINHTY2.7.10.1;Receptor protein-tyrosine kinase. 238
  • Domain: Ig-like C2-type
LDVVERSPH2.7.10.1;Receptor protein-tyrosine kinase. 246
  • Domain: Ig-like C2-type
ERSPHRPILQAGLP2.7.10.1;Receptor protein-tyrosine kinase. 250 -
PILQAGLPAN2.7.10.1;Receptor protein-tyrosine kinase. 256
  • Domain: Ig-like C2-type
CKVYSDAQPH2.7.10.1;Receptor protein-tyrosine kinase. 278
  • Domain: Ig-like C2-type
PYLKVLKAAG2.7.10.1;Receptor protein-tyrosine kinase. 307
  • Domain: Ig-like C2-type
  • Gene: FGFR2
AGVNTTD2.7.10.1;Receptor protein-tyrosine kinase. 315
  • Domain: Ig-like C2-type
EDAGEYTCLAGNSIG2.7.10.1;Receptor protein-tyrosine kinase. 335
  • Domain: Ig-like C2-type
SAWLTVL2.7.10.1;Receptor protein-tyrosine kinase. 354
  • Domain: Ig-like C2-type
SQPAVHKL2.7.10.1;Receptor protein-tyrosine kinase. 411 -
PLRRQVTV2.7.10;Protein-tyrosine kinases. 423 -
RRQVTVS2.7.10;Protein-tyrosine kinases. 425 -
SSMNSNTPLVRI2.7.10.1;Receptor protein-tyrosine kinase. 436 -
SEYELPEDP2.7.10.1;Receptor protein-tyrosine kinase. 464 -
LGKPLGEGCFGQV2.7.10.1;Receptor protein-tyrosine kinase. 483
  • Domain: Protein kinase
GIDKDKP2.7.10.1;Receptor protein-tyrosine kinase. 502
  • Domain: Protein kinase
VAVKMLK2.7.10.1;Receptor protein-tyrosine kinase. 514
  • Binding Site K=Lysine at location 517 on the protein
  • Binding site description: ATP (By similarity).
  • Domain: Protein kinase
EKDLSDL2.7.10.1;Receptor protein-tyrosine kinase. 525
  • Domain: Protein kinase
SEMEMMK2.7.10.1;Receptor protein-tyrosine kinase. 533
  • Domain: Protein kinase
NIINLLG2.7.10.1;Receptor protein-tyrosine kinase. 546
  • Domain: Protein kinase
CTQDGPLY2.7.10.1;Receptor protein-tyrosine kinase. 554
  • Domain: Protein kinase
GPLYVIVE2.7.10.1;Receptor protein-tyrosine kinase. 558
  • Domain: Protein kinase
LRARRPP2.7.10.1;Receptor protein-tyrosine kinase. 576
  • Domain: Protein kinase
RRPPGMEY2.7.10.1;Receptor protein-tyrosine kinase. 579
  • Domain: Protein kinase
TFKDLVSC2.7.10.1;Receptor protein-tyrosine kinase. 599
  • Domain: Protein kinase
ARGMEYLAS2.7.10.1;Receptor protein-tyrosine kinase. 611
  • Domain: Protein kinase
CIHRDLAARNVLV2.7.10.1;Receptor protein-tyrosine kinase. 622
  • Active Site D=Aspartic acid at location 626 on the protein
  • Active Site Description: Proton acceptor (By similarity
  • Domain: Protein kinase
RDLAARN2.7.10;Protein-tyrosine kinases. 625
  • Active Site D=Aspartic acid at location 626 on the protein
  • Active Site Description: Proton acceptor (By similarity
  • Domain: Protein kinase
AARNVLV2.7.10;Protein-tyrosine kinases. 628
  • Domain: Protein kinase
VMKIADFGLAR2.7.10.1;Receptor protein-tyrosine kinase. 639
  • Domain: Protein kinase
DFGLARDI2.7.10.1;Receptor protein-tyrosine kinase. 644
  • Domain: Protein kinase
IDYYKKT2.7.10.1;Receptor protein-tyrosine kinase. 654
  • Domain: Protein kinase
LPVKWMA2.7.10.1;Receptor protein-tyrosine kinase. 665
  • Domain: Protein kinase
PVKWMAPE2.7.10.1;Receptor protein-tyrosine kinase. 666
  • Domain: Protein kinase
EALFDRVYT2.7.10.1;Receptor protein-tyrosine kinase. 673
  • Domain: Protein kinase
YTHQSDVWS2.7.10.1;Receptor protein-tyrosine kinase. 680
  • Domain: Protein kinase
SDVWSFGVLMWE2.7.10;Protein-tyrosine kinases. 684
  • Domain: Protein kinase
WEIFTLGGSP2.7.10.1;Receptor protein-tyrosine kinase. 694
  • Domain: Protein kinase
PVEELFKLLKEGHRMD2.7.10.1;Receptor protein-tyrosine kinase. 708
  • Domain: Protein kinase
EGHRMDKP2.7.10.1;Receptor protein-tyrosine kinase. 718
  • Domain: Protein kinase
NCTNELY2.7.10.1;Receptor protein-tyrosine kinase. 727
  • Domain: Protein kinase
PSQRPTFKQLVE2.7.10.1;Receptor protein-tyrosine kinase. 744
  • Domain: Protein kinase
LVEDLDR2.7.10.1;Receptor protein-tyrosine kinase. 753
  • Domain: Protein kinase
TNEEYLDL2.7.10.1;Receptor protein-tyrosine kinase. 765
  • Domain: Protein kinase
  • Gene: FGFR2
SGDDSVF2.7.10.1;Receptor protein-tyrosine kinase. 792 -
GDDSVFSPDPM2.7.10.1;Receptor protein-tyrosine kinase. 793
  • Gene: FGFR2

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MVSWGRFICLVVVTMATLSLARPSFSLVEDTTLEPEEPPTKYQISQPEVYVAAPGESLEVRCLLKDAAVISWTKDGVHLGPNNRTVLIGEYLQIKGATPR
DSGLYACTASRTVDSETWYFMVNVTDAISSGDDEDDTDGAEDFVSENSNNKRAPYWTNTEKMEKRLHAVPAANTVKFRCPAGGNPMPTMRWLKNGKEFKQ
EHRIGGYKVRNQHWSLI
MESVVPSDKGNYTCVVENEYGSINHTYHLDVVERSPHRPILQAGLPANASTVVGGDVEFVCKVYSDAQPHIQWIKHVEKNGSK
YGPDGL
PYLKVLKAAGVNTTDKEIEVLYIRNVTFEDAGEYTCLAGNSIGISFHSAWLTVLPAPGREKEITASPDYLEIAIYCIGVFLIACMVVTVILCRM
KNTTKKPDFS
SQPAVHKLTKRIPLRRQVTVSAESSSSMNSNTPLVRITTRLSSTADTPMLAGVSEYELPEDPKWEFPRDKLTLGKPLGEGCFGQVVMAEA
V
GIDKDKPKEAVTVAVKMLKDDATEKDLSDLVSEMEMMKMIGKHKNIINLLGACTQDGPLYVIVEYASKGNLREYLRARRPPGMEYSYDINRVPEEQMTF
KDLVSC
TYQLARGMEYLASQKCIHRDLAARNVLVTENNVMKIADFGLARDINNIDYYKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLMWEIFTLG
GSP
YPGIPVEELFKLLKEGHRMDKPANCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRILTLTTNEEYLDLSQPLEQYSPSYPDTRSSCSSGDDSVFSP
DPM
PYEPCLPQYPHINGSVKT



DME EC Prediction for this protein is: 2.7.10.1
Check another protein