Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
CEVVMGNLEI2.7.10.1;Receptor protein-tyrosine kinase. 56 -
REVTGYVLVA2.7.10.1;Receptor protein-tyrosine kinase. 81 -
ECAGGCSGP2.7.10.1;Receptor protein-tyrosine kinase. 230 -
DTDCFAC2.7.10.1;Receptor protein-tyrosine kinase. 240 -
FNDSGACVPRCP2.7.10.1;Receptor protein-tyrosine kinase. 249
  • Gene: ERBB3
PLVYNKLTFQLEPNPH2.7.10.1;Receptor protein-tyrosine kinase. 262
  • Gene: ERBB3
CPHNFVVD2.7.10.1;Receptor protein-tyrosine kinase. 290 -
QTVDSSNID2.7.10.1;Receptor protein-tyrosine kinase. 341 -
LNIQSWPP2.7.10.1;Receptor protein-tyrosine kinase. 397 -
SLKEISAG2.7.10.1;Receptor protein-tyrosine kinase. 445 -
VCDPLCS2.7.10.1;Receptor protein-tyrosine kinase. 499 -
CFSCHPEC2.7.10.1;Receptor protein-tyrosine kinase. 549
  • Gene: ERBB3
TCNGSGS2.7.10.1;Receptor protein-tyrosine kinase. 564
  • Domain: Ig-like C2-type
KETELRK2.7.10.1;Receptor protein-tyrosine kinase. 705 -
SLQLVTQ2.7.10.1;Receptor protein-tyrosine kinase. 782 -
AARNVLL2.7.10;Protein-tyrosine kinases. 836
  • Domain: Protein kinase
YTHQSDVWS2.7.10.1;Receptor protein-tyrosine kinase. 888
  • Domain: Protein kinase
SDVWSYGVT2.7.10;Protein-tyrosine kinases. 892
  • Domain: Protein kinase
YGVTVWE2.7.10.1;Receptor protein-tyrosine kinase. 897
  • Domain: Protein kinase
MVKCWMID2.7.10.1;Receptor protein-tyrosine kinase. 944
  • Domain: Protein kinase
MARDPPRYLVI2.7.10.1;Receptor protein-tyrosine kinase. 968 -
AFDNPDYW2.7.10.1;Receptor protein-tyrosine kinase. 1322 -

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MRANDALQVLGLLFSLARGSEVGNSQAVCPGTLNGLSVTGDAENQYQTLYKLYERCEVVMGNLEIVLTGHNADLSFLQWIREVTGYVLVAMNEFSTLPLP
NLRVVRGTQVYDGKFAIFVMLNYNTNSSHALRQLRLTQLTEILSGGVYIEKNDKLCHMDTIDWRDIVRDRDAEIVVKDNGRSCPPCHEVCKGRCWGPGSE
DCQTLTKTICAPQCNGHCFGPNPNQCCHD
ECAGGCSGPQDTDCFACRHFNDSGACVPRCPQPLVYNKLTFQLEPNPHTKYQYGGVCVASCPHNFVVDQTS
CVRACPPDKMEVDKNGLKMCEPCGGLCPKACEGTGSGSRF
QTVDSSNIDGFVNCTKILGNLDFLITGLNGDPWHKIPALDPEKLNVFRTVREITGYLNIQ
SWPP
HMHNFSVFSNLTTIGGRSLYNRGFSLLIMKNLNVTSLGFRSLKEISAGRIYISANRQLCYHHSLNWTKVLRGPTEERLDIKHNRPRRDCVAEGKVC
DPLCS
SGGCWGPGPGQCLSCRNYSRGGVCVTHCNFLNGEPREFAHEAECFSCHPECQPMEGTATCNGSGSDTCAQCAHFRDGPHCVSSCPHGVLGAKGPI
YKYPDVQNECRPCHENCTQGCKGPELQDCLGQTLVLIGKTHLTMALTVIAGLVVIFMMLGGTFLYWRGRRIQNKRAMRRYLERGESIEPLDPSEKANKVL
ARIF
KETELRKLKVLGSGVFGTVHKGVWIPEGESIKIPVCIKVIEDKSGRQSFQAVTDHMLAIGSLDHAHIVRLLGLCPGSSLQLVTQYLPLGSLLDHVR
QHRGALGPQLLLNWGVQIAKGMYYLEEHGMVHRNL
AARNVLLKSPSQVQVADFGVADLLPPDDKQLLYSEAKTPIKWMALESIHFGKYTHQSDVWSYGVT
VWE
LMTFGAEPYAGLRLAEVPDLLEKGERLAQPQICTIDVYMVMVKCWMIDENIRPTFKELANEFTRMARDPPRYLVIKRESGPGIAPGPEPHGLTNKKL
EEVELEPELDLDLDLEAEEDNLATTTLGSALSLPVGTLNRPRGSQSLLSPSSGYMPMNQGNLGESCQESAVSGSSERCPRPVSLHPMPRGCLASESSEGH
VTGSEAELQEKVSMCRSRSRSRSPRPRGDSAYHSQRHSLLTPVTPLSPPGLEEEDVNGYVMPDTHLKGTPSSREGTLSSVGLSSVLGTEEEDEDEEYEYM
NRRRRHSPPHPPRPSSLEELGYEYMDVGSDLSASLGSTQSCPLHPVPIMPTAGTTPDEDYEYMNRQRDGGGPGGDYAAMGACPASEQGYEEMRAFQGPGH
QAPHVHYARLKTLRSLEATDS
AFDNPDYWHSRLFPKANAQRT



DME EC Prediction for this protein is: 2.7.10.1
Check another protein