Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
RIKKFAIYRWDPDK1.3.5.1;Succinate dehydrogenase (ubiquinone). 38
  • Gene: DHSB
VDLNKCGPMVLDALIKIKNE1.3.5.1;Succinate dehydrogenase (ubiquinone). 63
  • Domain: 2Fe-2S ferredoxin-ty
  • Gene: DHSB
DSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDT1.3.5.1;Succinate dehydrogenase (ubiquinone). 84
  • Metal Site C=Cysteine at location 93 on the protein
  • Metal Site Description: Iron-sulfur 1 (2Fe-2S) (By sim
  • Domain: 2Fe-2S ferredoxin-ty
  • Gene: DHSB
KIYPLPHMYV1.3.5.1;Succinate dehydrogenase (ubiquinone). 126
  • Domain: 2Fe-2S ferredoxin-ty
  • Gene: DHSB
PLPHMYVIKDLV1.3.5.1;Succinate dehydrogenase (ubiquinone). 129
  • Domain: 2Fe-2S ferredoxin-ty
QYKSIEP1.3.5.1;Succinate dehydrogenase (ubiquinone). 149 -
GKQQYLQS1.3.5.1;Succinate dehydrogenase (ubiquinone). 166
  • Gene: DHSB
YLGPAVL1.3.5.1;Succinate dehydrogenase (ubiquinone). 206
  • Domain: 4Fe-4S ferredoxin-ty
  • Gene: DHSB
LNPGKAIA1.3.5.1;Succinate dehydrogenase (ubiquinone). 257
  • Gene: DHSB

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MAAVVALSLRRRLPATTLGGACLQASRGAQTAAATAPRIKKFAIYRWDPDKAGDKPHMQTYEVDLNKCGPMVLDALIKIKNEVDSTLTFRRSCREGICGS
CAMNINGGNTLACTRRIDT
NLNKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEEREKLDGLYECILCACCSTSCPSYW
WNGDK
YLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTRTCPKGLNPGKAIAEIKKMMATYKEKKASV



DME EC Prediction for this protein is: 1.3.5.1
Check another protein