Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
LFLLSPH5.4.99.2;Methylmalonyl-CoA mutase. 8
  • Gene: MUTA
QRLLHQQQPLHPEWAALAKKQLKGKNPE5.4.99.2;Methylmalonyl-CoA mutase. 30
  • Gene: MUTA
WHTPEGI5.4.99.2;Methylmalonyl-CoA mutase. 61 -
RGPYPTMY5.4.99.2;Methylmalonyl-CoA mutase. 93 -
RQYAGFST5.4.99.2;Methylmalonyl-CoA mutase. 108 -
GLSVAFDL5.4.99.2;Methylmalonyl-CoA mutase. 133 -
THRGYDSD5.4.99.2;Methylmalonyl-CoA mutase. 142 -
GDVGMAGVA5.4.99.2;Methylmalonyl-CoA mutase. 155 -
VSMTMNGAV5.4.99.2;Methylmalonyl-CoA mutase. 184 -
GTIQNDILKEFMVRNTYI5.4.99.2;Methylmalonyl-CoA mutase. 215 -
MPKFNSISISGYH5.4.99.2;Methylmalonyl-CoA mutase. 253 -
ISISGYHMQEAG5.4.99.2;Methylmalonyl-CoA mutase. 259 -
FAPRLSFFW5.4.99.2;Methylmalonyl-CoA mutase. 301 -
MEIAKMRA5.4.99.2;Methylmalonyl-CoA mutase. 317 -
QTSGWSLTEQDP5.4.99.2;Methylmalonyl-CoA mutase. 352 -
TQSLHTN5.4.99.2;Methylmalonyl-CoA mutase. 382 -
NSFDEALGLPTVKSARIARNT5.4.99.2;Methylmalonyl-CoA mutase. 388
  • Gene: MUTA
SARIARNTQ5.4.99.2;Methylmalonyl-CoA mutase. 401 -
EEMGGMAKAVAEGIPKLRIEECAARRQARIDSGSEVIVG5.4.99.2;Methylmalonyl-CoA mutase. 450
  • Gene: MUTA
VIVGVNKY5.4.99.2;Methylmalonyl-CoA mutase. 485 -
VLAIDNTSVRN5.4.99.2;Methylmalonyl-CoA mutase. 502
  • Gene: MUTA
CAASGDGNILALAV5.4.99.2;Methylmalonyl-CoA mutase. 540
  • Gene: MUTA
TVGEITDA5.4.99.2;Methylmalonyl-CoA mutase. 561 -
KKVFGEHKANDRMVSGAYRQEFGESKEI5.4.99.2;Methylmalonyl-CoA mutase. 570
  • Gene: MUTA
KFMEREGRR5.4.99.2;Methylmalonyl-CoA mutase. 606
  • Gene: MUTA
AKMGQDGHDRG5.4.99.2;Methylmalonyl-CoA mutase. 620
  • Metal Site H=Histidine at location 627 on the protein
  • Metal Site Description: Cobalt (cobalamin axial ligand
  • Domain: B12-binding
DGHDRGAKVIATGFADLGFDVDIGPLFQTPREVA5.4.99.2;Methylmalonyl-CoA mutase. 625
  • Metal Site H=Histidine at location 627 on the protein
  • Metal Site Description: Cobalt (cobalamin axial ligand
  • Domain: B12-binding
  • Gene: MUTA
AQQAVDADVH5.4.99.2;Methylmalonyl-CoA mutase. 658
  • Domain: B12-binding
  • Gene: MUTA
AAGHKTLVPELIKEL5.4.99.2;Methylmalonyl-CoA mutase. 675
  • Domain: B12-binding
  • Gene: MUTA
LGRPDILVMCGGVIPPQDYEFL5.4.99.2;Methylmalonyl-CoA mutase. 692
  • Domain: B12-binding
  • Gene: MUTA
EVGVSNVFGPGTRIP5.4.99.2;Methylmalonyl-CoA mutase. 715
  • Domain: B12-binding
  • Gene: MUTA
AAVQVLDDIEKCL5.4.99.2;Methylmalonyl-CoA mutase. 731
  • Domain: B12-binding
  • Gene: MUTA
DIEKCLEKKQQS5.4.99.2;Methylmalonyl-CoA mutase. 738
  • Domain: B12-binding
  • Gene: MUTA

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MLRAKNQLFLLSPHYLRQVKESSGSRLIQQRLLHQQQPLHPEWAALAKKQLKGKNPEDLIWHTPEGISIKPLYSKRDTMDLPEELPGVKPFTRGPYPTMY
TFRPWTIRQYAGFSTVEESNKFYKDNIKAGQQGLSVAFDLATHRGYDSDNPRVRGDVGMAGVAIDTVEDTKILFDGIPLEKMSVSMTMNGAVIPVLANFI
VTGEEQGVPKEKLT
GTIQNDILKEFMVRNTYIFPPEPSMKIIADIFEYTAKHMPKFNSISISGYHMQEAGADAILELAYTLADGLEYSRTGLQAGLTIDE
FAPRLSFFWGIGMNFYMEIAKMRAGRRLWAHLIEKMFQPKNSKSLLLRAHCQTSGWSLTEQDPYNNIVRTAIEAMAAVFGGTQSLHTNSFDEALGLPTVK
SARIARNTQ
IIIQEESGIPKVADPWGGSYMMECLTNDVYDAALKLINEIEEMGGMAKAVAEGIPKLRIEECAARRQARIDSGSEVIVGVNKYQLEKEDAV
E
VLAIDNTSVRNRQIEKLKKIKSSRDQALAERCLAALTECAASGDGNILALAVDASRARCTVGEITDALKKVFGEHKANDRMVSGAYRQEFGESKEITSA
IKRVH
KFMEREGRRPRLLVAKMGQDGHDRGAKVIATGFADLGFDVDIGPLFQTPREVAQQAVDADVHAVGISTLAAGHKTLVPELIKELNSLGRPDILVM
CGGVIPPQDYEFL
FEVGVSNVFGPGTRIPKAAVQVLDDIEKCLEKKQQSV



DME EC Prediction for this protein is: 5.4.99.2
Check another protein