Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
WSLVMES2.7.10.1;Receptor protein-tyrosine kinase. 207
  • Domain: Ig-like C2-type
MESVVPSD2.7.10.1;Receptor protein-tyrosine kinase. 211
  • Domain: Ig-like C2-type
YTCLVEN2.7.10.1;Receptor protein-tyrosine kinase. 222
  • Domain: Ig-like C2-type
LDVLERS2.7.10.1;Receptor protein-tyrosine kinase. 239
  • Domain: Ig-like C2-type
ERSPHRPILQAGLP2.7.10.1;Receptor protein-tyrosine kinase. 243 -
PILQAGLPAN2.7.10.1;Receptor protein-tyrosine kinase. 249
  • Domain: Ig-like C2-type
CKVYSDAQPH2.7.10.1;Receptor protein-tyrosine kinase. 271
  • Domain: Ig-like C2-type
PHIQWLK2.7.10.1;Receptor protein-tyrosine kinase. 279
  • Domain: Ig-like C2-type
SEVEVLYL2.7.10.1;Receptor protein-tyrosine kinase. 313
  • Domain: Ig-like C2-type
  • Gene: FGFR4
EDAGEYTCLAGNSIG2.7.10.1;Receptor protein-tyrosine kinase. 326
  • Domain: Ig-like C2-type
SAWLTVL2.7.10.1;Receptor protein-tyrosine kinase. 345
  • Domain: Ig-like C2-type
WEFPRDRL2.7.10.1;Receptor protein-tyrosine kinase. 460 -
LGKPLGEGCFGQV2.7.10.1;Receptor protein-tyrosine kinase. 469
  • Domain: Protein kinase
VAVKMLK2.7.10.1;Receptor protein-tyrosine kinase. 500
  • Binding Site K=Lysine at location 503 on the protein
  • Binding site description: ATP (By similarity).
  • Domain: Protein kinase
NIINLLG2.7.10.1;Receptor protein-tyrosine kinase. 532
  • Domain: Protein kinase
GPLYVIVE2.7.10.1;Receptor protein-tyrosine kinase. 544
  • Domain: Protein kinase
LRARRPP2.7.10.1;Receptor protein-tyrosine kinase. 562
  • Domain: Protein kinase
CIHRDLAARNVLV2.7.10.1;Receptor protein-tyrosine kinase. 608
  • Active Site D=Aspartic acid at location 612 on the protein
  • Active Site Description: Proton acceptor (By similarity
  • Domain: Protein kinase
RDLAARN2.7.10;Protein-tyrosine kinases. 611
  • Active Site D=Aspartic acid at location 612 on the protein
  • Active Site Description: Proton acceptor (By similarity
  • Domain: Protein kinase
AARNVLV2.7.10;Protein-tyrosine kinases. 614
  • Domain: Protein kinase
VMKIADFGLAR2.7.10.1;Receptor protein-tyrosine kinase. 625
  • Domain: Protein kinase
IDYYKKT2.7.10.1;Receptor protein-tyrosine kinase. 640
  • Domain: Protein kinase
LPVKWMA2.7.10.1;Receptor protein-tyrosine kinase. 651
  • Domain: Protein kinase
PVKWMAPE2.7.10.1;Receptor protein-tyrosine kinase. 652
  • Domain: Protein kinase
EALFDRVYT2.7.10.1;Receptor protein-tyrosine kinase. 659
  • Domain: Protein kinase
YTHQSDVWS2.7.10.1;Receptor protein-tyrosine kinase. 666
  • Domain: Protein kinase
GILLWEIF2.7.10.1;Receptor protein-tyrosine kinase. 676
  • Domain: Protein kinase
WEIFTLGGSP2.7.10.1;Receptor protein-tyrosine kinase. 680
  • Domain: Protein kinase
MRECWHA2.7.10.1;Receptor protein-tyrosine kinase. 722
  • Domain: Protein kinase
PSQRPTFKQLVE2.7.10.1;Receptor protein-tyrosine kinase. 730
  • Domain: Protein kinase

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MRLLLALLGVLLSVPGPPVLSLEASEEVELEPCLAPSLEQQEQELTVALGQPVRLCCGRAERGGHWYKEGSRLAPAGRVRGWRGRLEIASFLPEDAGRYL
CLARGSMIVLQNLTLITGDSLTSSNDDEDPKSHRDPSNRHSYPQQAPYWTHPQRMEKKLHAVPAGNTVKFRCPAAGNPTPTIRWLKDGQAFHGENRIGGI
RLRHQH
WSLVMESVVPSDRGTYTCLVENAVGSIRYNYLLDVLERSPHRPILQAGLPANTTAVVGSDVELLCKVYSDAQPHIQWLKHIVINGSSFGADGFP
YVQVLKTADINS
SEVEVLYLRNVSAEDAGEYTCLAGNSIGLSYQSAWLTVLPEEDPTWTAAAPEARYTDIILYASGSLALAVLLLLAGLYRGQALHGRHP
RPPATVQKLSRFPLARQFSLESGSSGKSSSSLVRGVRLSSSGPALLAGLVSLDLPLDPL
WEFPRDRLVLGKPLGEGCFGQVVRAEAFGMDPARPDQASTV
AVKMLK
DNASDKDLADLVSEMEVMKLIGRHKNIINLLGVCTQEGPLYVIVECAAKGNLREFLRARRPPGPDLSPDGPRSSEGPLSFPVLVSCAYQVARGM
QYLESRK
CIHRDLAARNVLVTEDNVMKIADFGLARGVHHIDYYKKTSNGRLPVKWMAPEALFDRVYTHQSDVWSFGILLWEIFTLGGSPYPGIPVEELFS
LLREGHRMDRPPHCPPELYGL
MRECWHAAPSQRPTFKQLVEALDKVLLAVSEEYLDLRLTFGPYSPSGGDASSTCSSSDSVFSHDPLPLGSSSFPFGSGV
QT



DME EC Prediction for this protein is: 2.7.10.1
Check another protein