Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
SSGDDED2.7.10.1;Receptor protein-tyrosine kinase. 130 -
AVPAANT2.7.10.1;Receptor protein-tyrosine kinase. 165
  • Domain: Ig-like C2-type
NTVRFRC2.7.10.1;Receptor protein-tyrosine kinase. 170
  • Domain: Ig-like C2-type
GEHRIGGI2.7.10.1;Receptor protein-tyrosine kinase. 197
  • Domain: Ig-like C2-type
WSLVMES2.7.10.1;Receptor protein-tyrosine kinase. 211
  • Domain: Ig-like C2-type
MESVVPSD2.7.10.1;Receptor protein-tyrosine kinase. 215
  • Domain: Ig-like C2-type
LDVLERS2.7.10.1;Receptor protein-tyrosine kinase. 243
  • Domain: Ig-like C2-type
ERSPHRPILQAGLP2.7.10.1;Receptor protein-tyrosine kinase. 247 -
PILQAGLPAN2.7.10.1;Receptor protein-tyrosine kinase. 253
  • Domain: Ig-like C2-type
CKVYSDAQPH2.7.10.1;Receptor protein-tyrosine kinase. 275
  • Domain: Ig-like C2-type
PHIQWLK2.7.10.1;Receptor protein-tyrosine kinase. 283
  • Domain: Ig-like C2-type
EDAGEYTCLAGNSIG2.7.10.1;Receptor protein-tyrosine kinase. 332
  • Domain: Ig-like C2-type
SHHSAWL2.7.10.1;Receptor protein-tyrosine kinase. 348
  • Domain: Ig-like C2-type
NVSELELP2.7.10.1;Receptor protein-tyrosine kinase. 453
  • Gene: FGFR3
LGKPLGEGCFGQV2.7.10.1;Receptor protein-tyrosine kinase. 474
  • Domain: Protein kinase
VAVKMLK2.7.10.1;Receptor protein-tyrosine kinase. 505
  • Binding Site K=Lysine at location 508 on the protein
  • Binding site description: ATP (By similarity).
  • Domain: Protein kinase
SEMEMMK2.7.10.1;Receptor protein-tyrosine kinase. 524
  • Domain: Protein kinase
NIINLLG2.7.10.1;Receptor protein-tyrosine kinase. 537
  • Domain: Protein kinase
GPLYVLVEYA2.7.10.1;Receptor protein-tyrosine kinase. 549
  • Domain: Protein kinase
LRARRPP2.7.10.1;Receptor protein-tyrosine kinase. 567
  • Domain: Protein kinase
DYSFDTCK2.7.10.1;Receptor protein-tyrosine kinase. 576
  • Domain: Protein kinase
  • Gene: FGFR3
TFKDLVSC2.7.10.1;Receptor protein-tyrosine kinase. 590
  • Domain: Protein kinase
QVARGME2.7.10.1;Receptor protein-tyrosine kinase. 600
  • Domain: Protein kinase
ARGMEYLAS2.7.10.1;Receptor protein-tyrosine kinase. 602
  • Domain: Protein kinase
CIHRDLAARNVLV2.7.10.1;Receptor protein-tyrosine kinase. 613
  • Active Site D=Aspartic acid at location 617 on the protein
  • Active Site Description: Proton acceptor (By similarity
  • Domain: Protein kinase
RDLAARN2.7.10;Protein-tyrosine kinases. 616
  • Active Site D=Aspartic acid at location 617 on the protein
  • Active Site Description: Proton acceptor (By similarity
  • Domain: Protein kinase
AARNVLV2.7.10;Protein-tyrosine kinases. 619
  • Domain: Protein kinase
VMKIADFGLAR2.7.10.1;Receptor protein-tyrosine kinase. 630
  • Domain: Protein kinase
LPVKWMA2.7.10.1;Receptor protein-tyrosine kinase. 656
  • Domain: Protein kinase
PVKWMAPE2.7.10.1;Receptor protein-tyrosine kinase. 657
  • Domain: Protein kinase
EALFDRVYT2.7.10.1;Receptor protein-tyrosine kinase. 664
  • Domain: Protein kinase
YTHQSDVWS2.7.10.1;Receptor protein-tyrosine kinase. 671
  • Domain: Protein kinase
WEIFTLGGSP2.7.10.1;Receptor protein-tyrosine kinase. 685
  • Domain: Protein kinase
PVEELFKLLKEGHRMD2.7.10.1;Receptor protein-tyrosine kinase. 699
  • Domain: Protein kinase
EGHRMDKP2.7.10.1;Receptor protein-tyrosine kinase. 709
  • Domain: Protein kinase
MRECWHA2.7.10.1;Receptor protein-tyrosine kinase. 727
  • Domain: Protein kinase
PSQRPTFKQLVE2.7.10.1;Receptor protein-tyrosine kinase. 735
  • Domain: Protein kinase
LVEDLDR2.7.10.1;Receptor protein-tyrosine kinase. 744
  • Domain: Protein kinase
PFEQYSP2.7.10.1;Receptor protein-tyrosine kinase. 766 -
SGDDSVF2.7.10.1;Receptor protein-tyrosine kinase. 783 -

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MGAPACALALCVAVAIVAGASSESLGTEQRVVGRAAEVPGPEPGQQEQLVFGSGDAVELSCPPPGGGPMGPTVWVKDGTGLVPSERVLVGPQRLQVLNAS
HEDSGAYSCRQRLTQRVLCHFSVRVTDAP
SSGDDEDGEDEAEDTGVDTGAPYWTRPERMDKKLLAVPAANTVRFRCPAAGNPTPSISWLKNGREFRGEHR
IGGI
KLRHQQWSLVMESVVPSDRGNYTCVVENKFGSIRQTYTLDVLERSPHRPILQAGLPANQTAVLGSDVEFHCKVYSDAQPHIQWLKHVEVNGSKVGP
DGTPYVTVLKTAGANTTDKELEVLSLHNVTF
EDAGEYTCLAGNSIGFSHHSAWLVVLPAEEELVEADEAGSVYAGILSYGVGFFLFILVVAAVTLCRLRS
PPKKGLGSPTVHKISRFPLKRQVSLESNASMSSNTPLVRIARLSSGEGPTLA
NVSELELPADPKWELSRARLTLGKPLGEGCFGQVVMAEAIGIDKDRAA
KPVT
VAVKMLKDDATDKDLSDLVSEMEMMKMIGKHKNIINLLGACTQGGPLYVLVEYAAKGNLREFLRARRPPGLDYSFDTCKPPEEQLTFKDLVSCAYQ
VARGMEYLAS
QKCIHRDLAARNVLVTEDNVMKIADFGLARDVHNLDYYKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLLWEIFTLGGSPYPGIPV
EELFKLLKEGHRMDKP
ANCTHDLYMIMRECWHAAPSQRPTFKQLVEDLDRVLTVTSTDEYLDLSAPFEQYSPGGQDTPSSSSSGDDSVFAHDLLPPAPPS
SGGSRT



DME EC Prediction for this protein is: 2.7.10.1
Check another protein