Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
LIVRRGQ2.3.2.13;Protein-glutamine gamma-glutamyltransferase. 139 -
YILFNPWC2.3.2.13;Protein-glutamine gamma-glutamyltransferase. 244 -
SAMVNSLDDNGVLIGNW2.3.2.13;Protein-glutamine gamma-glutamyltransferase. 326
  • Gene: TGM1
YGQCWVFA2.3.2.13;Protein-glutamine gamma-glutamyltransferase. 374
  • Active Site C=Cysteine at location 377 on the protein
  • Active Site Description: By similarity.
WNFHVWNDCWM2.3.2.13;Protein-glutamine gamma-glutamyltransferase. 433
  • Active Site H=Histidine at location 436 on the protein
  • Active Site Description: By similarity.
WMKRPDLP2.3.2.13;Protein-glutamine gamma-glutamyltransferase. 442 -
FIFAEVN2.3.2.13;Protein-glutamine gamma-glutamyltransferase. 493 -
FAEVNSD2.3.2.13;Protein-glutamine gamma-glutamyltransferase. 495
  • Metal Site N=Asparagine at location 499 on the protein
  • Metal Site Description: Calcium (By similarity).
YKHPEGS2.3.2.13;Protein-glutamine gamma-glutamyltransferase. 544
  • Metal Site E=Glutamic acid at location 548 on the protein
  • Metal Site Description: Calcium (By similarity).
  • Gene: TGM1
MPVAYKEY2.3.2.13;Protein-glutamine gamma-glutamyltransferase. 648
  • Gene: TGM1
MLLNVSGHVKE2.3.2.13;Protein-glutamine gamma-glutamyltransferase. 665
  • Gene: TGM1
RTPDLSLTLLGAAVVGQECEVQIVF2.3.2.13;Protein-glutamine gamma-glutamyltransferase. 689
  • Gene: TGM1
TLTNVVFRLEGSGLQRPK2.3.2.13;Protein-glutamine gamma-glutamyltransferase. 720
  • Gene: TGM1

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MMDGPRSDVGRWGGNPLQPPTTPSPEPEPEPDGRSRRGGGRSFWARCCGCCSCRNAADDDWGPEPSDSRGRGSSSGTRRPGSRGSDSRRPVSRGSGVNAA
GDGTIREGMLVVNGVDLLSSRSDQNRREHHTDEYEYDE
LIVRRGQPFHMLLLLSRTYESSDRITLELLIGNNPEVGKGTHVIIPVGKGGSGGWKAQVVKA
SGQNLNLRVHTSPNAIIGKFQFTVRTQSDAGEFQLPFDPRNEI
YILFNPWCPEDIVYVDHEDWRQEYVLNESGRIYYGTEAQIGERTWNYGQFDHGVLDA
CLYILDRRGMPYGGRGDPVNVSRVI
SAMVNSLDDNGVLIGNWSGDYSRGTNPSAWVGSVEILLSYLRTGYSVPYGQCWVFAGVTTTVLRCLGLATRTVTN
FNSAHDTDTSLTMDIYFDENMKPLEHLNHDSV
WNFHVWNDCWMKRPDLPSGFDGWQVVDATPQETSSGIFCCGPCSVESIKNGLVYMKYDTPFIFAEVNS
D
KVYWQRQDDGSFKIVYVEEKAIGTLIVTKAISSNMREDITYLYKHPEGSDAERKAVETAAAHGSKPNVYANRGSAEDVAMQVEAQDAVMGQDLMVSVML
INHSSSRRTVKLHLYLSVTFYTGVSGTIFKETKKEVELAPGASDRVT
MPVAYKEYRPHLVDQGAMLLNVSGHVKESGQVLAKQHTFRLRTPDLSLTLLGA
AVVGQECEVQIVF
KNPLPVTLTNVVFRLEGSGLQRPKILNVGDIGGNETVTLRQSFVPVRPGPRQLIASLDSPQLSQVHGVIQVDVAPAPGDGGFFSDAG
GDSHLGETIPMASRGGA



DME EC Prediction for this protein is: 2.3.2.13
Check another protein