Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
SIVPTMHYQDSLPRLPIPKLEDT2.3.1.21;Carnitine O-palmitoyltransferase. 38
  • Gene: CPT2
NKHTSYIS2.3.1.21;Carnitine O-palmitoyltransferase. 106
  • Gene: CPT2
PWFDMYL2.3.1.21;Carnitine O-palmitoyltransferase. 115
  • Gene: CPT2
VLNFNPF2.3.1.21;Carnitine O-palmitoyltransferase. 128
  • Gene: CPT2
RATNMTVSA2.3.1.21;Carnitine O-palmitoyltransferase. 151
  • Gene: CPT2
FHLNPAKSDT2.3.1.21;Carnitine O-palmitoyltransferase. 176
  • Gene: CPT2
VNAYPLDMSQYFRLFN2.3.1.21;Carnitine O-palmitoyltransferase. 207
  • Gene: CPT2
FDVLDQDGNIV2.3.1.21;Carnitine O-palmitoyltransferase. 254
  • Gene: CPT2
QAHLKYIL2.3.1.21;Carnitine O-palmitoyltransferase. 270
  • Gene: CPT2
KVDSAVFCLCLDDFP2.3.1.21;Carnitine O-palmitoyltransferase. 317
  • Gene: CPT2
RWFDKSF2.3.1.21;Carnitine O-palmitoyltransferase. 350 -
AQLAFQM2.3.1.21;Carnitine O-palmitoyltransferase. 467
  • Gene: CPT2
FQMAFLRQYG2.3.1.21;Carnitine O-palmitoyltransferase. 471
  • Gene: CPT2
ATYESCSTAAFKHGRTET2.3.1.21;Carnitine O-palmitoyltransferase. 484
  • Binding Site Y=Tyrosine at location 486 on the protein
  • Binding site description: Carnitine (By similarity).
  • Gene: CPT2
DRHLFAL2.3.1.21;Carnitine O-palmitoyltransferase. 553 -
LGGFAPVV2.3.1.21;Carnitine O-palmitoyltransferase. 599
  • Gene: CPT2
WIGCNVSSY2.3.1.21;Carnitine O-palmitoyltransferase. 620
  • Gene: CPT2

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MVPRLLLRAWPRGPAVGPGAPSRPLSAGSGPGQYLQRSIVPTMHYQDSLPRLPIPKLEDTIRRYLSAQKPLLNDGQFRKTEQFCKSFENGIGKELHEQLV
ALDKQ
NKHTSYISGPWFDMYLSARDSVVLNFNPFMAFNPDPKSEYNDQLTRATNMTVSAIRFLKTLRAGLLEPEVFHLNPAKSDTITFKRLIRFVPSSLS
WYGAYL
VNAYPLDMSQYFRLFNSTRLPKPSRDELFTDDKARHLLVLRKGNFYIFDVLDQDGNIVSPSEIQAHLKYILSDSSPAPEFPLAYLTSENRDIWA
ELRQKLMSSGNEESLR
KVDSAVFCLCLDDFPIKDLVHLSHNMLHGDGTNRWFDKSFNLIIAKDGSTAVHFEHSWGDGVAVLRFFNEVFKDSTQTPAVTPQ
SQPATTDSTVTVQKLNFELTDALKTGITAAKEKFDATMKTLTIDCVQFQRGGKEFLKKQKLSPDAV
AQLAFQMAFLRQYGQTVATYESCSTAAFKHGRTE
T
IRPASVYTKRCSEAFVREPSRHSAGELQQMMVECSKYHGQLTKEAAMGQGFDRHLFALRHLAAAKGIILPELYLDPAYGQINHNVLSTSTLSSPAVNLG
GFAPVV
SDGFGVGYAVHDNWIGCNVSSYPGRNAREFLQCVEKALEDMFDALEGKSIKS



DME EC Prediction for this protein is: 2.3.1.21
Check another protein