Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data

Specific Peptide	EC	Function	Location of SP in Protein	Predicted Features
PHSRPYMA	3.4.21;	Serine endopeptidases.	36	Domain: Peptidase S1
VLTAAHC	3.4.21;	Serine endopeptidases.	66	Active Site H=Histidine at location 71 on the protein Active Site Description: Charge relay system (By simila Domain: Peptidase S1
VLQELNVTVVT	3.4.21;	Serine endopeptidases.	169	Domain: Peptidase S1
GDSGGPL	3.4.21;	Serine endopeptidases.	201	Active Site S=Serine at location 203 on the protein Active Site Description: Charge relay system (By simila Domain: Peptidase S1
SGGPLIC	3.4.21;	Serine endopeptidases.	203	Active Site S=Serine at location 203 on the protein Active Site Description: Charge relay system (By simila Domain: Peptidase S1

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MAHRPPSPALASVLLALLLSGAARAAEIVGGHEAQPHSRPYMASLQMRGNPGSHFCGGTLIHPSFVLTAAHCLRDIPQRLVNVVLGAHNVRTQEPTQQHF
SVAQVFLNNYDAENKLNDVLLIQLSSPANLSASVATVQLPQQDQPVPHGTQCLAMGWGRVGAHDPPAQVLQELNVTVVTFFCRPHNICTFVPRRKAGICF
GDSGGPLICDGIIQGIDSFVIWGCATRLFPDFFTRVALYVDWIRSTLRRVEAKGRP


DME EC Prediction for this protein is: 3.4.21
Check another protein