Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
PHSRPYMA3.4.21;Serine endopeptidases. 36
  • Domain: Peptidase S1
VLTAAHC3.4.21;Serine endopeptidases. 66
  • Active Site H=Histidine at location 71 on the protein
  • Active Site Description: Charge relay system (By simila
  • Domain: Peptidase S1
VLQELNVTVVT3.4.21;Serine endopeptidases. 169
  • Domain: Peptidase S1
GDSGGPL3.4.21;Serine endopeptidases. 201
  • Active Site S=Serine at location 203 on the protein
  • Active Site Description: Charge relay system (By simila
  • Domain: Peptidase S1
SGGPLIC3.4.21;Serine endopeptidases. 203
  • Active Site S=Serine at location 203 on the protein
  • Active Site Description: Charge relay system (By simila
  • Domain: Peptidase S1

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MAHRPPSPALASVLLALLLSGAARAAEIVGGHEAQPHSRPYMASLQMRGNPGSHFCGGTLIHPSFVLTAAHCLRDIPQRLVNVVLGAHNVRTQEPTQQHF
SVAQVFLNNYDAENKLNDVLLIQLSSPANLSASVATVQLPQQDQPVPHGTQCLAMGWGRVGAHDPPAQ
VLQELNVTVVTFFCRPHNICTFVPRRKAGICF
GDSGGPLICDGIIQGIDSFVIWGCATRLFPDFFTRVALYVDWIRSTLRRVEAKGRP



DME EC Prediction for this protein is: 3.4.21
Check another protein