Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
RTPIGSF2.3.1.9;Acetyl-CoA C-acetyltransferase. 49 -
TKLGSIA2.3.1.9;Acetyl-CoA C-acetyltransferase. 65 -
GEGQAPTRQA2.3.1.9;Acetyl-CoA C-acetyltransferase. 98
  • Gene: THIL
NKVCASGMK2.3.1.9;Acetyl-CoA C-acetyltransferase. 123
  • Active Site C=Cysteine at location 126 on the protein
  • Active Site Description: Acyl-thioester intermediate (B
AGGMESMS2.3.1.9;Acetyl-CoA C-acetyltransferase. 150 -
IVKDGLTDVYNK2.3.1.9;Acetyl-CoA C-acetyltransferase. 179 -
EDEEYKRVDFSK2.3.1.9;Acetyl-CoA C-acetyltransferase. 252 -
VDFSKVPKLK2.3.1.9;Acetyl-CoA C-acetyltransferase. 259
  • Binding Site K=Lysine at location 263 on the protein
  • Binding site description: Coenzyme A (By similarity).
  • Gene: THIL
GTVTAAN2.3.1;Transferring groups other than amino-acyl groups. 276
  • Metal Site A=Alanine at location 280 on the protein
  • Metal Site Description: Potassium; via carbonyl oxygen
STLNDGAAALVLMTA2.3.1.9;Acetyl-CoA C-acetyltransferase. 284
  • Binding Site S=Serine at location 284 on the protein
  • Binding site description: Coenzyme A (By similarity).
RLNVTPLA2.3.1.9;Acetyl-CoA C-acetyltransferase. 303 -
KKEDIAMWE2.3.1.9;Acetyl-CoA C-acetyltransferase. 343 -
GGAVSLGHP2.3.1.9;Acetyl-CoA C-acetyltransferase. 378
  • Active Site H=Histidine at location 385 on the protein
  • Active Site Description: Proton acceptor (By similarity
  • Metal Site V=Valine at location 381 on the protein
  • Metal Site Description: Potassium; via carbonyl oxygen
CNGGGGAS2.3.1.9;Acetyl-CoA C-acetyltransferase. 413
  • Active Site C=Cysteine at location 413 on the protein
  • Active Site Description: Proton acceptor (By similarity

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MAVLAALLRSGARSRSPLLRRLVQEIRYVERSYVSKPTLKEVVIVSATRTPIGSFLGSLSLLPATKLGSIAIQGAIEKAGIPKEEVKEAYMGNVLQGGEG
QAPTRQA
VLGAGLPISTPCTTINKVCASGMKAIMMASQSLMCGHQDVMVAGGMESMSNVPYVMNRGSTPYGGVKLEDLIVKDGLTDVYNKIHMGSCAENT
AKKLNIARNEQDAYAINSYTRSKAAWEAGKFGNEVIPVTVTVKGQPDVVVK
EDEEYKRVDFSKVPKLKTVFQKENGTVTAANASTLNDGAAALVLMTADA
AK
RLNVTPLARIVAFADAAVEPIDFPIAPVYAASMVLKDVGLKKEDIAMWEVNEAFSLVVLANIKMLEIDPQKVNINGGAVSLGHPIGMSGARIVGHLTH
ALKQGEYGLASI
CNGGGGASAMLIQKL



DME EC Prediction for this protein is: 2.3.1.9
Check another protein