Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
LDDPDLK2.1.1.37;DNA (cytosine-5-)-methyltransferase. 360
  • Gene: DNMT1
SKIVVEFLQ2.1.1.37;DNA (cytosine-5-)-methyltransferase. 509
  • Gene: DNMT1
NRFTEDSLLRHAQFVV2.1.1.37;DNA (cytosine-5-)-methyltransferase. 543
  • Gene: DNMT1
EMPSPKK2.1.1.37;DNA (cytosine-5-)-methyltransferase. 711
  • Gene: DNMT1
YIKGSNLDAP2.1.1.37;DNA (cytosine-5-)-methyltransferase. 979
  • Domain: BAH
  • Gene: DNMT1
KFYRPENTH2.1.1.37;DNA (cytosine-5-)-methyltransferase. 1020
  • Domain: BAH
  • Gene: DNMT1
FSGCGGL2.1.1.37;DNA (cytosine-5-)-methyltransferase. 1145 -
TVFTEDCN2.1.1.37;DNA (cytosine-5-)-methyltransferase. 1185
  • Gene: DNMT1
LLKLVMAGE2.1.1.37;DNA (cytosine-5-)-methyltransferase. 1194
  • Gene: DNMT1
GGPPCQG2.1.1.37;DNA (cytosine-5-)-methyltransferase. 1222
  • Active Site C=Cysteine at location 1226 on the protein
  • Active Site Description: By similarity.
YSKFKNSL2.1.1.37;DNA (cytosine-5-)-methyltransferase. 1240
  • Gene: DNMT1
RMGYQCTFG2.1.1.37;DNA (cytosine-5-)-methyltransferase. 1289
  • Gene: DNMT1
FPEPLHVFAPRACQLSVVVDDKKFVSNITR2.1.1.37;DNA (cytosine-5-)-methyltransferase. 1327
  • Gene: DNMT1
RTITVRDTMSDLP2.1.1.37;DNA (cytosine-5-)-methyltransferase. 1363
  • Gene: DNMT1
YQPILRDHICKDMS2.1.1.37;DNA (cytosine-5-)-methyltransferase. 1405
  • Gene: DNMT1
PGSDWRDLPNI2.1.1.37;DNA (cytosine-5-)-methyltransferase. 1432
  • Gene: DNMT1
TLIPWCLPHTGNRHN2.1.1.37;DNA (cytosine-5-)-methyltransferase. 1494
  • Gene: DNMT1
GNAVPPPLA2.1.1.37;DNA (cytosine-5-)-methyltransferase. 1577
  • Gene: DNMT1

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MPARTAPARVPTLAVPAISLPDDVRRRLKDLERDSLTEKECVKEKLNLLHEFLQTEIKNQLCDLETKLRKEELSEEGYLAKVKSLLNKDLSLENGAHAYN
REVNGRLENGNQARSEARRVGMADANSPPKPLSKPRTPRRSKSDGEAKPEPSPSPRITRKSTRQTTITSHFAKGPAKRKPQEESERAKSDESIKEEDKDQ
DEKRRRVTSRERVARPLPAEEPERAKSGTRTEKEEERDEKEEKRLRSQTKEPTPKQKLKEEPDREARAGVQADEDEDGDEKDEKKHRSQPKDLAAKRRPE
EKEPEKVNPQISDEKDEDEKEEKRRKTTPKEPTEKKMARAKTVMNSKTHPPKCIQCGQY
LDDPDLKYGQHPPDAVDEPQMLTNEKLSIFDANESGFESYE
ALPQHKLTCFSVYCKHGHLCPIDTGLIEKNIELFFSGSAKPIYDDDPSLEGGVNGKNLGPINEWWITGFDGGEKALIGFSTSFAEYILMDPSPEYAPIFG
LMQEKIYI
SKIVVEFLQSNSDSTYEDLINKIETTVPPSGLNLNRFTEDSLLRHAQFVVEQVESYDEAGDSDEQPIFLTPCMRDLIKLAGVTLGQRRAQAR
RQTIRHSTREKDRGPTKATTTKLVYQIFDTFFAEQIEKDDREDKENAFKRRRCGVCEVCQQPECGKCKACKDMVKFGGSGRSKQACQERRCPNMAMKEAD
DDEEVDDNIP
EMPSPKKMHQGKKKKQNKNRISWVGEAVKTDGKKSYYKKVCIDAETLEVGDCVSVIPDDSSKPLYLARVTALWEDSSNGQMFHAHWFCAG
TDTVLGATSDPLELFLVDECEDMQLSYIHSKVKVIYKAPSENWAMEGGMDPESLLEGDDGKTYFYQLWYDQDYARFESPPKTQPTEDNKFKFCVSCARLA
EMRQKEIPRVLEQLEDLDSRVLYYSATKNGILYRVGDGVYLPPEAFTFNIKLSSPVKRPRKEPVDEDLYPEHYRKYSD
YIKGSNLDAPEPYRIGRIKEIF
CPKKSNGRPNETDIKIRVN
KFYRPENTHKSTPASYHADINLLYWSDEEAVVDFKAVQGRCTVEYGEDLPECVQVYSMGGPNRFYFLEAYNAKSKSFEDPP
NHARSPGNKGKGKGKGKGKPKSQACEPSEPEIEIKLPKLRTLDV
FSGCGGLSEGFHQAGISDTLWAIEMWDPAAQAFRLNNPGSTVFTEDCNILLKLVMA
GE
TTNSRGQRLPQKGDVEMLCGGPPCQGFSGMNRFNSRTYSKFKNSLVVSFLSYCDYYRPRFFLLENVRNFVSFKRSMVLKLTLRCLVRMGYQCTFGVLQ
AGQYGVAQTRRRAIILAAAPGEKLPL
FPEPLHVFAPRACQLSVVVDDKKFVSNITRLSSGPFRTITVRDTMSDLPEVRNGASALEISYNGEPQSWFQRQL
RGAQ
YQPILRDHICKDMSALVAARMRHIPLAPGSDWRDLPNIEVRLSDGTMARKLRYTHHDRKNGRSSSGALRGVCSCVEAGKACDPAARQFNTLIPWCL
PHTGNRHN
HWAGLYGRLEWDGFFSTTVTNPEPMGKQGRVLHPEQHRVVSVRECARSQGFPDTYRLFGNILDKHRQVGNAVPPPLAKAIGLEIKLCMLAKA
RESASAKIKEEEAAKD



DME EC Prediction for this protein is: 2.1.1.37
Check another protein