Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
LPVPPLQQ2.3.1;Transferring groups other than amino-acyl groups. 134 -
DMYLNNRLALPVNSSP2.3.1.6;Choline O-acetyltransferase. 201
  • Gene: CLAT
LISGVLSYK2.3.1.6;Choline O-acetyltransferase. 238
  • Gene: CLAT
INFRRLSEGDLFTQLRKI2.3.1.6;Choline O-acetyltransferase. 319
  • Gene: CLAT
KDSTNRDSLDMIERC2.3.1.6;Choline O-acetyltransferase. 370
  • Gene: CLAT
ALQLLHGGG2.3.1.6;Choline O-acetyltransferase. 404
  • Gene: CLAT
QFVVGRDG2.3.1.6;Choline O-acetyltransferase. 427
  • Gene: CLAT
SELPAPRRLRWKCSP2.3.1.6;Choline O-acetyltransferase. 475
  • Gene: CLAT
LASSAEKLQ2.3.1.6;Choline O-acetyltransferase. 495
  • Gene: CLAT
YGKTFIK2.3.1;Transferring groups other than amino-acyl groups. 519 -
RLVPTYESASIRRF2.3.1.6;Choline O-acetyltransferase. 549
  • Binding Site S=Serine at location 558 on the protein
  • Binding site description: Coenzyme A (By similarity).
  • Gene: CLAT
GRVDNIR2.3.1.6;Choline O-acetyltransferase. 565
  • Gene: CLAT
TPEALAFV2.3.1.6;Choline O-acetyltransferase. 574
  • Gene: CLAT

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MGLRTAKKRGLGGGGKWKREEGGGTRGRREVRPACFLQSGGRGDPGDVGGPAGNPGCSPHPRAATRPPPLPAHTPAHTPEWCGAASAEAAEPRRAGPHLC
IPAPGLTKTPILEKVPRKMAAKTPSSEESGLPK
LPVPPLQQTLATYLQCMRHLVSEEQFRKSQAIVQQFGAPGGLGETLQQKLLERQEKTANWVSEYWLN
DMYLNNRLALPVNSSPAVIFARQHFPGTDDQLRFAASLISGVLSYKALLDSHSIPTDCAKGQLSGQPLCMKQYYGLFSSYRLPGHTQDTLVAQNSSIMPE
PEHVIVACCNQFFVLDVV
INFRRLSEGDLFTQLRKIVKMASNEDERLPPIGLLTSDGRSEWAEARTVLVKDSTNRDSLDMIERCICLVCLDAPGGVELSD
THR
ALQLLHGGGYSKNGANRWYDKSLQFVVGRDGTCGVVCEHSPFDGIVLVQCTEHLLKHVTQSSRKLIRADSVSELPAPRRLRWKCSPEIQGHLASSAE
KLQ
RIVKNLDFIVYKFDNYGKTFIKKQKCSPDAFIQVALQLAFYRLHRRLVPTYESASIRRFQEGRVDNIRSATPEALAFVRAVTDHKAAVPASEKLLLL
KDAIRAQTAYTVMAITGMAIDNHLLALRELARAMCKELPEMFMDETYLMSNRFVLSTSQVPTTTEMFCCYGPVVPNGYGACYNPQPETILFCISSFHSCK
ETSSSKFAKAVEESLIDMRDLCSLLPPTESKPLATKEKATRPSQGHQP



DME EC Prediction for this protein is: 2.3.1.6
Check another protein