Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
GWEEISG2.7.10.1;Receptor protein-tyrosine kinase. 51 -
TYQVCNV2.7.10.1;Receptor protein-tyrosine kinase. 67 -
QNNWLRT2.7.10.1;Receptor protein-tyrosine kinase. 78 -
NWLRTNW2.7.10.1;Receptor protein-tyrosine kinase. 80 -
AQKIYVE2.7.10.1;Receptor protein-tyrosine kinase. 92 -
KFTLRDCNS2.7.10.1;Receptor protein-tyrosine kinase. 100 -
CKETFNL2.7.10.1;Receptor protein-tyrosine kinase. 116 -
DTIAADE2.7.10.1;Receptor protein-tyrosine kinase. 144 -
GFYLAFQD2.7.10.1;Receptor protein-tyrosine kinase. 178 -
LAFQDVGAC2.7.10.1;Receptor protein-tyrosine kinase. 181 -
ALVSVRV2.7.10.1;Receptor protein-tyrosine kinase. 191 -
KKCPFTV2.7.10.1;Receptor protein-tyrosine kinase. 200 -
LAMFPDT2.7.10.1;Receptor protein-tyrosine kinase. 209 -
SLVEVRG2.7.10.1;Receptor protein-tyrosine kinase. 222 -
EGEWLVPIGKC2.7.10.1;Receptor protein-tyrosine kinase. 247 -
CNAGYEER2.7.10.1;Receptor protein-tyrosine kinase. 259 -
ACRPGFYKA2.7.10.1;Receptor protein-tyrosine kinase. 272 -
DTGGRKD2.7.10.1;Receptor protein-tyrosine kinase. 350
  • Domain: Fibronectin type-III
NVRFLPRQ2.7.10.1;Receptor protein-tyrosine kinase. 379
  • Domain: Fibronectin type-III
  • Gene: EPHA3
GLTNTTVTV2.7.10.1;Receptor protein-tyrosine kinase. 388
  • Domain: Fibronectin type-III
  • Gene: EPHA3
AHTNYTFE2.7.10.1;Receptor protein-tyrosine kinase. 401
  • Domain: Fibronectin type-III
AAVSITT2.7.10.1;Receptor protein-tyrosine kinase. 426
  • Domain: Fibronectin type-III
TTNQAAPS2.7.10.1;Receptor protein-tyrosine kinase. 431 -
KDRTSRNS2.7.10.1;Receptor protein-tyrosine kinase. 445
  • Domain: Fibronectin type-III
  • Gene: EPHA3
LSWQEPEHPNG2.7.10.1;Receptor protein-tyrosine kinase. 455
  • Domain: Fibronectin type-III
PNGIILDYE2.7.10.1;Receptor protein-tyrosine kinase. 463
  • Domain: Fibronectin type-III
LDYEVKY2.7.10.1;Receptor protein-tyrosine kinase. 468
  • Domain: Fibronectin type-III
YEVKYYEK2.7.10.1;Receptor protein-tyrosine kinase. 470
  • Domain: Fibronectin type-III
QETSYTI2.7.10.1;Receptor protein-tyrosine kinase. 480
  • Domain: Fibronectin type-III
YVFQIRA2.7.10.1;Receptor protein-tyrosine kinase. 505
  • Domain: Fibronectin type-III
RARTAAGYG2.7.10.1;Receptor protein-tyrosine kinase. 510
  • Domain: Fibronectin type-III
FEFETSP2.7.10.1;Receptor protein-tyrosine kinase. 524
  • Domain: Fibronectin type-III
DPHTYEDP2.7.10.1;Receptor protein-tyrosine kinase. 598 -
QAVHEFAKE2.7.10.1;Receptor protein-tyrosine kinase. 607 -
FAKELDA2.7.10.1;Receptor protein-tyrosine kinase. 612 -
GAGEFGEV2.7.10.1;Receptor protein-tyrosine kinase. 628
  • Domain: Protein kinase
GYTEKQRRDFL2.7.10.1;Receptor protein-tyrosine kinase. 658
  • Domain: Protein kinase
EASIMGQF2.7.10.1;Receptor protein-tyrosine kinase. 670
  • Domain: Protein kinase
IMGQFDHPNII2.7.10.1;Receptor protein-tyrosine kinase. 673
  • Domain: Protein kinase
NIIRLEGV2.7.10.1;Receptor protein-tyrosine kinase. 681
  • Domain: Protein kinase
LEGVVTKS2.7.10.1;Receptor protein-tyrosine kinase. 685
  • Domain: Protein kinase
MIVTEYMENGSLD2.7.10.1;Receptor protein-tyrosine kinase. 696
  • Domain: Protein kinase
QLVGMLRG2.7.10.1;Receptor protein-tyrosine kinase. 722
  • Domain: Protein kinase
SGMKYLSDM2.7.10.1;Receptor protein-tyrosine kinase. 732
  • Domain: Protein kinase
GMKYLSDM2.7.10;Protein-tyrosine kinases. 733
  • Domain: Protein kinase
DMGYVHRDLAARNIL2.7.10.1;Receptor protein-tyrosine kinase. 739
  • Active Site D=Aspartic acid at location 746 on the protein
  • Active Site Description: Proton acceptor (By similarity
  • Domain: Protein kinase
RDLAARN2.7.10;Protein-tyrosine kinases. 745
  • Active Site D=Aspartic acid at location 746 on the protein
  • Active Site Description: Proton acceptor (By similarity
  • Domain: Protein kinase
NLVCKVSDFGLSR2.7.10.1;Receptor protein-tyrosine kinase. 757
  • Domain: Protein kinase
LEDDPEAAYTT2.7.10.1;Receptor protein-tyrosine kinase. 771
  • Domain: Protein kinase
RWTSPEA2.7.10.1;Receptor protein-tyrosine kinase. 789
  • Domain: Protein kinase
  • Gene: EPHA3
RKFTSASD2.7.10.1;Receptor protein-tyrosine kinase. 799
  • Domain: Protein kinase
SDVWSYGI2.7.10;Protein-tyrosine kinases. 805
  • Domain: Protein kinase
WEVMSYGERPY2.7.10.1;Receptor protein-tyrosine kinase. 815
  • Domain: Protein kinase
SYGERPYW2.7.10.1;Receptor protein-tyrosine kinase. 819
  • Domain: Protein kinase
MSNQDVI2.7.10.1;Receptor protein-tyrosine kinase. 828
  • Domain: Protein kinase
YRLPPPMDCP2.7.10.1;Receptor protein-tyrosine kinase. 841
  • Domain: Protein kinase
QLMLDCW2.7.10.1;Receptor protein-tyrosine kinase. 855
  • Domain: Protein kinase
LMLDCWQK2.7.10.1;Receptor protein-tyrosine kinase. 856
  • Domain: Protein kinase
RPKFEQIV2.7.10.1;Receptor protein-tyrosine kinase. 868
  • Domain: Protein kinase
LDKLIRNP2.7.10.1;Receptor protein-tyrosine kinase. 878
  • Domain: Protein kinase
AAARPSNLLLDQSN2.7.10.1;Receptor protein-tyrosine kinase. 894
  • Gene: EPHA3
IFTGVEYSSCDTIAKISTDDMKKVGVTVVGPQKKI2.7.10.1;Receptor protein-tyrosine kinase. 931
  • Domain: SAM
  • Gene: EPHA3

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MDCQLSILLLLSCSVLDSFGELIPQPSNEVNLLDSKTIQGELGWISYPSHGWEEISGVDEHYTPIRTYQVCNVMDHSQNNWLRTNWVPRNSAQKIYVELK
FTLRDCNS
IPLVLGTCKETFNLYYMESDDDHGVKFREHQFTKIDTIAADESFTQMDLGDRILKLNTEIREVGPVNKKGFYLAFQDVGACVALVSVRVYFK
KCPFTV
KNLAMFPDTVPMDSQSLVEVRGSCVNNSKEEDPPRMYCSTEGEWLVPIGKCSCNAGYEERGFMCQACRPGFYKALDGNMKCAKCPPHSSTQEDG
SMNCRCENNYFRADKDPPSMACTRPPSSPRNVISNINETSVILDWSWPL
DTGGRKDVTFNIICKKCGWNIKQCEPCSPNVRFLPRQFGLTNTTVTVTDLL
AHTNYTFEIDAVNGVSELSSPPRQFAAVSITTNQAAPSPVLTIKKDRTSRNSISLSWQEPEHPNGIILDYEVKYYEKQEQETSYTILRARGTNVTISSLK
PDTI
YVFQIRARTAAGYGTNSRKFEFETSPDSFSISGESSQVVMIAISAAVAIILLTVVIYVLIGRFCGYKSKHGADEKRLHFGNGHLKLPGLRTYVDPH
TYEDP
TQAVHEFAKELDATNISIDKVVGAGEFGEVCSGRLKLPSKKEISVAIKTLKVGYTEKQRRDFLGEASIMGQFDHPNIIRLEGVVTKSKPVMIVTE
YMENGSLD
SFLRKHDAQFTVIQLVGMLRGIASGMKYLSDMGYVHRDLAARNILINSNLVCKVSDFGLSRVLEDDPEAAYTTRGGKIPIRWTSPEAIAYRK
FTSASDVWSYGI
VLWEVMSYGERPYWEMSNQDVIKAVDEGYRLPPPMDCPAALYQLMLDCWQKDRNNRPKFEQIVSILDKLIRNPGSLKIITSAAARPSN
LLLDQSN
VDITTFRTTGDWLNGVWTAHCKEIFTGVEYSSCDTIAKISTDDMKKVGVTVVGPQKKIISSIKALETQSKNGPVPV



DME EC Prediction for this protein is: 2.7.10.1
Check another protein