Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
PLVDLSYDSALEV1.14.13.39;Nitric-oxide synthase. 71
  • Domain: PDZ
  • Gene: NOS1
ASETHVVLILRGPEGFTT1.14.13.39;Nitric-oxide synthase. 88
  • Domain: PDZ
  • Gene: NOS1
LETTFTGDGTPKTIRVTQPLG1.14.13.39;Nitric-oxide synthase. 107
  • Gene: NOS1
VVLTDTLHLKSTLETGCTE1.14.13.39;Nitric-oxide synthase. 315
  • Gene: NOS1
QYYSSIKR1.14.13.39;Nitric-oxide synthase. 369 -
LQVFDAR1.14.13.39;Nitric-oxide synthase. 429 -
GNLRSAIT1.14.13.39;Nitric-oxide synthase. 458 -
ITIFPQR1.14.13.39;Nitric-oxide synthase. 464 -
DGKHDFR1.14.13.39;Nitric-oxide synthase. 472 -
QLIRYAGY1.14.13.39;Nitric-oxide synthase. 483 -
RFDVLPLLLQA1.14.13.39;Nitric-oxide synthase. 521 -
PPELVLEVP1.14.13.39;Nitric-oxide synthase. 542 -
LPAVSNMLLEIGGLEF1.14.13.39;Nitric-oxide synthase. 569 -
GWYMGTE1.14.13.39;Nitric-oxide synthase. 591
  • Binding Site Y=Tyrosine at location 593 on the protein
  • Binding site description: Substrate.
VEINIAVL1.14.13.39;Nitric-oxide synthase. 636 -
VTIVDHH1.14.13.39;Nitric-oxide synthase. 651 -
RGGCPADW1.14.13.39;Nitric-oxide synthase. 674 -
TPVFHQEM1.14.13.39;Nitric-oxide synthase. 693 -
RAIGFKKLA1.14.13.39;Nitric-oxide synthase. 732 -
MAKRVKATILY1.14.13.39;Nitric-oxide synthase. 754 -
ATETGKS1.14.13.39;Nitric-oxide synthase. 765
  • Domain: Flavodoxin-like
VVTSTFGNGD1.14.13.39;Nitric-oxide synthase. 809
  • Domain: Flavodoxin-like
STFGNGDPPENG1.14.13.39;Nitric-oxide synthase. 812
  • Domain: Flavodoxin-like
CALMEMRHPNS1.14.13.39;Nitric-oxide synthase. 828
  • Domain: Flavodoxin-like
  • Gene: NOS1
VFGLGSR1.14.13.39;Nitric-oxide synthase. 886
  • Domain: Flavodoxin-like
YPHFCAF1.14.13.39;Nitric-oxide synthase. 894
  • Domain: Flavodoxin-like
GQEEAFR1.14.13.39;Nitric-oxide synthase. 927
  • Domain: Flavodoxin-like
SRQNLQSP1.14.13.39;Nitric-oxide synthase. 1004
  • Domain: FAD-binding FR-type
NLQSPKSSR1.14.13.39;Nitric-oxide synthase. 1007
  • Domain: FAD-binding FR-type
LQYQPGDH1.14.13.39;Nitric-oxide synthase. 1030
  • Domain: FAD-binding FR-type
LDITTPP1.14.13.39;Nitric-oxide synthase. 1103
  • Domain: FAD-binding FR-type
VLEEFPS1.14.13.39;Nitric-oxide synthase. 1154
  • Domain: FAD-binding FR-type
LLQPRYYS1.14.13.39;Nitric-oxide synthase. 1174
  • Domain: FAD-binding FR-type
GVCSSWLNR1.14.13.39;Nitric-oxide synthase. 1214
  • Domain: FAD-binding FR-type
LPRNPQVPCILVGPGT1.14.13.39;Nitric-oxide synthase. 1241
  • Domain: FAD-binding FR-type
  • Gene: NOS1
APFRSFWQQR1.14.13.39;Nitric-oxide synthase. 1259 -
PCPMVLVFGCRQSKIDHIYREE1.14.13.39;Nitric-oxide synthase. 1279
  • Gene: NOS1
VCGDVTMA1.14.13.39;Nitric-oxide synthase. 1353 -

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MEDHMFGVQQIQPNVISVRLFKRKVGGLGFLVKERVSKPPVIISDLIRGGAAEQSGLIQAGDIILAVNGRPLVDLSYDSALEVLRGIASETHVVLILRGP
EGFTT
HLETTFTGDGTPKTIRVTQPLGPPTKAVDLSHQPPAGKEQPLAVDGASGPGNGPQHAYDDGQEAGSLPHANGLAPRPPGQDPAKKATRVSLQGRG
ENNELLKEIEPVLSLLTSGSRGVKGGAPAKAEMKDMGIQVDRDLDGKSHKPLPLGVENDRVFNDLWGKGNVPVVLNNPYSEKEQPPTSGKQSPTKNGSPS
KCPRFLKVKNWETE
VVLTDTLHLKSTLETGCTEYICMGSIMHPSQHARRPEDVRTKGQLFPLAKEFIDQYYSSIKRFGSKAHMERLEEVNKEIDTTSTYQ
LKDTELIYGAKHAWRNASRCVGRIQWSK
LQVFDARDCTTAHGMFNYICNHVKYATNKGNLRSAITIFPQRTDGKHDFRVWNSQLIRYAGYKQPDGSTLGD
PANVQFTEICIQQGWKPPRG
RFDVLPLLLQANGNDPELFQIPPELVLEVPIRHPKFEWFKDLGLKWYGLPAVSNMLLEIGGLEFSACPFSGWYMGTEIGV
RDYCDNSRYNILEEVAKKMNLDMRKTSSLWKDQAL
VEINIAVLYSFQSDKVTIVDHHSATESFIKHMENEYRCRGGCPADWVWIVPPMSGSITPVFHQEM
LNYRLTPSFEYQPDPWNTHVWKGTNGTPTKRRAIGFKKLAEAVKFSAKLMGQAMAKRVKATILYATETGKSQAYAKTLCEIFKHAFDAKVMSMEEYDIVH
LEHETLVL
VVTSTFGNGDPPENGEKFGCALMEMRHPNSVQEERKSYKVRFNSVSSYSDSQKSSGDGPDLRDNFESAGPLANVRFSVFGLGSRAYPHFCAF
GHAVDTLLEELGGERILKMREGDELCGQEEAFRTWAKKVFKAACDVFCVGDDVNIEKANNSLISNDRSWKRNKFRLTFVAEAPELTQGLSNVHKKRVSAA
RLL
SRQNLQSPKSSRSTIFVRLHTNGSQELQYQPGDHLGVFPGNHEDLVNALIERLEDAPPVNQMVKVELLEERNTALGVISNWTDELRLPPCTIFQAFK
YY
LDITTPPTPLQLQQFASLATSEKEKQRLLVLSKGLQEYEEWKWGKNPTIVEVLEEFPSIQMPATLLLTQLSLLQPRYYSISSSPDMYPDEVHLTVAIV
SYRTRDGEGPIHH
GVCSSWLNRIQADELVPCFVRGAPSFHLPRNPQVPCILVGPGTGIAPFRSFWQQRQFDIQHKGMNPCPMVLVFGCRQSKIDHIYREE
TLQAKNKGVFRELYTAYSREPDKPKKYVQDILQEQLAESVYRALKEQGGHIYVCGDVTMAADVLKAIQRIMTQQGKLSAEDAGVFISRMRDDNRYHEDIF
GVTLRTYEVTNRLRSESIAFIEESKKDTDEVFSS



DME EC Prediction for this protein is: 1.14.13.39
Check another protein