Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
SYRSPLA4.3.2.2;Adenylosuccinate lyase. 12
  • Gene: PUR8
TWRQLWLWLAEAEQTLGLPITDEQIQEMKSNL4.3.2.2;Adenylosuccinate lyase. 38
  • Gene: PUR8
HCCPKAA4.3.2.2;Adenylosuccinate lyase. 97
  • Gene: PUR8
IIHLGATSCYVGDNTDLI4.3.2.2;Adenylosuccinate lyase. 105
  • Gene: PUR8
LLLPKLARVISRLADFA4.3.2.2;Adenylosuccinate lyase. 130
  • Gene: PUR8
THFQPAQ4.3.2;Lyases acting on amides 158
  • Active Site H=Histidine at location 159 on the protein
  • Active Site Description: Proton acceptor (By similarity
QPAQLTTVGKRCCLWIQDLCMDLQNL4.3.2.2;Adenylosuccinate lyase. 161
  • Gene: PUR8
RGVKGTTGTQASFL4.3.2.2;Adenylosuccinate lyase. 196
  • Gene: PUR8
TDIRLLANLKE4.3.2.2;Adenylosuccinate lyase. 267
  • Gene: PUR8
QIGSSAMPYK4.3.2.2;Adenylosuccinate lyase. 286
  • Gene: PUR8
YKRNPMR4.3.2.2;Adenylosuccinate lyase. 294
  • Gene: PUR8
CSLARHL4.3.2.2;Adenylosuccinate lyase. 305
  • Gene: PUR8
TASVQWFERTLDDS4.3.2.2;Adenylosuccinate lyase. 321
  • Gene: PUR8
TLQNISEGLVVYPKVI4.3.2.2;Adenylosuccinate lyase. 354
  • Gene: PUR8
ELPFMATENIIMAM4.3.2.2;Adenylosuccinate lyase. 376
  • Gene: PUR8
EGGDNDLIERI4.3.2.2;Adenylosuccinate lyase. 417
  • Gene: PUR8
LLDPSSFTGRA4.3.2.2;Adenylosuccinate lyase. 443
  • Gene: PUR8
RFLEEEV4.3.2.2;Adenylosuccinate lyase. 459
  • Gene: PUR8

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MAAGGDHGSPDSYRSPLASRYASPEMCFVFSDRYKFRTWRQLWLWLAEAEQTLGLPITDEQIQEMKSNLENIDFKMAAEEEKRLRHDVMAHVHTFGHCCP
KAA
GIIHLGATSCYVGDNTDLIILRNALDLLLPKLARVISRLADFAKERASLPTLGFTHFQPAQLTTVGKRCCLWIQDLCMDLQNLKRVRDDLRFRGVKG
TTGTQASFL
QLFEGDDHKVEQLDKMVTEKAGFKRAFIITGQTYTRKVDIEVLSVLASLGASVHKICTDIRLLANLKEMEEPFEKQQIGSSAMPYKRNPMR
SERCCSLARHLMTLVMDPLQTASVQWFERTLDDSANRRICLAEAFLTADTILNTLQNISEGLVVYPKVIERRIRQELPFMATENIIMAMVKAGGSRQDCH
EKIRVLSQQAASVVKQ
EGGDNDLIERIQVDAYFSPIHSQLDHLLDPSSFTGRASQQVQRFLEEEVYPLLKPYESVMKVKAELCL



DME EC Prediction for this protein is: 4.3.2.2
Check another protein