Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
AAMADTFLEH2.7.1.40;Pyruvate kinase. 63 -
LDIDSEP2.7.1.40;Pyruvate kinase. 76 -
GPASRSV2.7.1.40;Pyruvate kinase. 95 -
RLNFSHG2.7.1.40;Pyruvate kinase. 116 -
NFSHGSHEYH2.7.1.40;Pyruvate kinase. 118 -
LDTKGPEIR2.7.1.40;Pyruvate kinase. 155
  • Metal Site D=Aspartic acid at location 156 on the protein
  • Metal Site Description: Potassium (By similarity).
DDGLISL2.7.1.40;Pyruvate kinase. 220 -
KGVNLPG2.7.1.40;Pyruvate kinase. 250 -
IKIISKIE2.7.1.40;Pyruvate kinase. 308
  • Active Site K=Lysine at location 313 on the protein
  • Active Site Description: By similarity.
SDGIMVARGD2.7.1.40;Pyruvate kinase. 330
  • Metal Site A=Alanine at location 336 on the protein
  • Metal Site Description: Magnesium (By similarity).
MVARGDLG2.7.1.40;Pyruvate kinase. 334
  • Metal Site A=Alanine at location 336 on the protein
  • Metal Site Description: Magnesium (By similarity).
EIPAEKV2.7.1.40;Pyruvate kinase. 343 -
ATQMLESMI2.7.1.40;Pyruvate kinase. 370 -
PRPTRAE2.7.1.40;Pyruvate kinase. 381 -
VANAVLDG2.7.1.40;Pyruvate kinase. 391 -
NAVLDGAD2.7.1.40;Pyruvate kinase. 393 -
MLSGETA2.7.1.40;Pyruvate kinase. 403 -
IAREAEAA2.7.1.40;Pyruvate kinase. 424 -
TGWRPGSG2.7.1.40;Pyruvate kinase. 556 -

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MSIQENISSLQLRSWVSKSQRDLAKSILIGAPGGPAGYLRRASVAQLTQELGTAFFQQQQLPAAMADTFLEHLCLLDIDSEPVAARSTSIIATIGPASRS
V
ERLKEMIKAGMNIARLNFSHGSHEYHAESIANVREAVESFAGSPLSYRPVAIALDTKGPEIRTGILQGGPESEVELVKGSQVLVTVDPAFRTRGNANTV
WVDYPNIVRVVPVGGRIYI
DDGLISLVVQKIGPEGLVTQVENGGVLGSRKGVNLPGAQVDLPGLSEQDVRDLRFGVEHGVDIVFASFVRKASDVAAVRAA
LGPEGHG
IKIISKIENHEGVKRFDEILEVSDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNLAGKPVVCATQMLESMITKPRPTRAETSDVANAVLDGAD
CIMLSGETAKGNFPVEAVKMQHAIAREAEAAVYHRQLFEELRRAAPLSRDPTEVTAIGAVEAAFKCCAAAIIVLTTTGRSAQLLSRYRPRAAVIAVTRSA
QAARQVHLCRGVFPLLYREPPEAIWADDVDRRVQFGIESGKLRGFLRVGDLVIVV
TGWRPGSGYTNIMRVLSIS



DME EC Prediction for this protein is: 2.7.1.40
Check another protein