Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
QYPVVDH1.3.5.1;Succinate dehydrogenase (ubiquinone). 54 -
EAGFNTAC1.3.5.1;Succinate dehydrogenase (ubiquinone). 82 -
TKLFPTRSHTVAAQGGINAALGNM1.3.5.1;Succinate dehydrogenase (ubiquinone). 91 -
LGDQDAIHYM1.3.5.1;Succinate dehydrogenase (ubiquinone). 133 -
ELENYGMPFSRT1.3.5.1;Succinate dehydrogenase (ubiquinone). 152 -
FGKGGQA1.3.5.1;Succinate dehydrogenase (ubiquinone). 180 -
CCVADRTGHSLLHTLYG1.3.5.1;Succinate dehydrogenase (ubiquinone). 190 -
EDGSIHR1.3.5.1;Succinate dehydrogenase (ubiquinone). 240 -
FSCTSAHTSTGDG1.3.5.1;Succinate dehydrogenase (ubiquinone). 264 -
RAGLPCQDLEFVQFHPTGIYG1.3.5.1;Succinate dehydrogenase (ubiquinone). 282
  • Binding Site H=Histidine at location 296 on the protein
  • Binding site description: Substrate (By similarity).
QDLEFVQFHPTGIYGAGCLITEG1.3.5.1;Succinate dehydrogenase (ubiquinone). 288
  • Binding Site H=Histidine at location 296 on the protein
  • Binding site description: Substrate (By similarity).
AKDLASRDVVSRSMT1.3.5.1;Succinate dehydrogenase (ubiquinone). 334
  • Active Site R=Arginine at location 340 on the protein
  • Active Site Description: Proton acceptor (By similarity
KDHVYLQLHHLPP1.3.5.1;Succinate dehydrogenase (ubiquinone). 361 -
RLPGISETAMIFAGVDVTKEPIPVLPTVHYNMGGIPTNY1.3.5.1;Succinate dehydrogenase (ubiquinone). 379
  • Binding Site H=Histidine at location 407 on the protein
  • Binding site description: Substrate (By similarity).
PTNYKGQV1.3.5.1;Succinate dehydrogenase (ubiquinone). 414 -
ASVHGANRLGANSLLDLVVFGRACAL1.3.5.1;Succinate dehydrogenase (ubiquinone). 444
  • Binding Site R=Arginine at location 451 on the protein
  • Binding site description: Substrate (By similarity).
NAGEESV1.3.5.1;Succinate dehydrogenase (ubiquinone). 487 -
NLDKLRF1.3.5.1;Succinate dehydrogenase (ubiquinone). 495 -
MQNHAAVFR1.3.5.1;Succinate dehydrogenase (ubiquinone). 519 -
WNTDLVE1.3.5.1;Succinate dehydrogenase (ubiquinone). 558 -
ETLELQNL1.3.5.1;Succinate dehydrogenase (ubiquinone). 564 -
AEARKESRGAHARED1.3.5.1;Succinate dehydrogenase (ubiquinone). 582 -
GQQKKPF1.3.5.1;Succinate dehydrogenase (ubiquinone). 612
  • Gene: DHSA
PFEEHWRKHTLSYVDV1.3.5.1;Succinate dehydrogenase (ubiquinone). 617
  • Gene: DHSA
TGKVTLEYRPVID1.3.5.1;Succinate dehydrogenase (ubiquinone). 634
  • Gene: DHSA
DCATVPPAI1.3.5.1;Succinate dehydrogenase (ubiquinone). 653
  • Gene: DHSA

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MSGVRGLSRLLSARRLALAKAWPTVLQTGTRGFHFTVDGNKRASAKVSDSISAQYPVVDHEFDAVVVGAGGAGLRAAFGLSEAGFNTACVTKLFPTRSHT
VAAQGGINAALGNM
EEDNWRWHFYDTVKGSDWLGDQDAIHYMTEQAPAAVVELENYGMPFSRTEDGKIYQRAFGGQSLKFGKGGQAHRCCCVADRTGHSL
LHTLYG
RSLRYDTSYFVEYFALDLLMENGECRGVIALCIEDGSIHRIRAKNTVVATGGYGRTYFSCTSAHTSTGDGTAMITRAGLPCQDLEFVQFHPTGI
YGAGCLITEG
CRGEGGILINSQGERFMERYAPVAKDLASRDVVSRSMTLEIREGRGCGPEKDHVYLQLHHLPPEQLATRLPGISETAMIFAGVDVTKEPI
PVLPTVHYNMGGIPTNYKGQV
LRHVNGQDQIVPGLYACGEAACASVHGANRLGANSLLDLVVFGRACALSIEESCRPGDKVPPIKPNAGEESVMNLDKLR
F
ADGSIRTSELRLSMQKSMQNHAAVFRVGSVLQEGCGKISKLYGDLKHLKTFDRGMVWNTDLVETLELQNLMLCALQTIYGAEARKESRGAHAREDYKVR
IDEYDYSKPIQ
GQQKKPFEEHWRKHTLSYVDVGTGKVTLEYRPVIDKTLNEADCATVPPAIRSY



DME EC Prediction for this protein is: 1.3.5.1
Check another protein