Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
KRGEYIK2.7.11.1;Non-specific serine/threonine protein kinase. 14
  • Domain: PH
PLNNFSVA2.7.11.1;Non-specific serine/threonine protein kinase. 51
  • Domain: PH
CQLMKTERP2.7.11.1;Non-specific serine/threonine protein kinase. 60
  • Domain: PH
LQWTTVIERTF2.7.11.1;Non-specific serine/threonine protein kinase. 78
  • Domain: PH
YLKLLGKGTFGKVILV2.7.11.1;Non-specific serine/threonine protein kinase. 152
  • Domain: Protein kinase
YYAMKIL2.7.11;Protein-serine/threonine kinases. 175
  • Binding Site K=Lysine at location 179 on the protein
  • Binding site description: ATP (By similarity).
  • Domain: Protein kinase
KILKKEVI2.7.11.1;Non-specific serine/threonine protein kinase. 179
  • Binding Site K=Lysine at location 179 on the protein
  • Binding site description: ATP (By similarity).
  • Domain: Protein kinase
EVAHTLTE2.7.11.1;Non-specific serine/threonine protein kinase. 191
  • Domain: Protein kinase
HPFLTAL2.7.11;Protein-serine/threonine kinases. 207
  • Domain: Protein kinase
HPFLTALKY2.7.11.1;Non-specific serine/threonine protein kinase. 207
  • Domain: Protein kinase
LKYSFQT2.7.11.1;Non-specific serine/threonine protein kinase. 213
  • Domain: Protein kinase
DRLCFVM2.7.11.1;Non-specific serine/threonine protein kinase. 221
  • Domain: Protein kinase
NGGELFFHL2.7.11.1;Non-specific serine/threonine protein kinase. 231
  • Domain: Protein kinase
LFFHLSRERVF2.7.11.1;Non-specific serine/threonine protein kinase. 235
  • Domain: Protein kinase
RFYGAEI2.7.11;Protein-serine/threonine kinases. 251
  • Domain: Protein kinase
AEIVSAL2.7.11.1;Non-specific serine/threonine protein kinase. 255
  • Domain: Protein kinase
LDYLHSE2.7.11.1;Non-specific serine/threonine protein kinase. 261
  • Domain: Protein kinase
VVYRDLK2.7.11;Protein-serine/threonine kinases. 270
  • Active Site D=Aspartic acid at location 274 on the protein
  • Active Site Description: Proton acceptor (By similarity
  • Domain: Protein kinase
RDLKLEN2.7.11;Protein-serine/threonine kinases. 273
  • Active Site D=Aspartic acid at location 274 on the protein
  • Active Site Description: Proton acceptor (By similarity
  • Domain: Protein kinase
NLMLDKD2.7.11.1;Non-specific serine/threonine protein kinase. 279
  • Domain: Protein kinase
LDKDGHIK2.7.11;Protein-serine/threonine kinases. 282
  • Domain: Protein kinase
IKITDFG2.7.11;Protein-serine/threonine kinases. 288
  • Domain: Protein kinase
IKITDFGL2.7.11.1;Non-specific serine/threonine protein kinase. 288
  • Domain: Protein kinase
DFGLCKE2.7.11;Protein-serine/threonine kinases. 292
  • Domain: Protein kinase
GTPEYLAPE2.7.11;Protein-serine/threonine kinases. 311
  • Domain: Protein kinase
YLAPEVL2.7.11;Protein-serine/threonine kinases. 315
  • Domain: Protein kinase
RAVDWWGLGV2.7.11;Protein-serine/threonine kinases. 328
  • Domain: Protein kinase
GVVMYEM2.7.11.1;Non-specific serine/threonine protein kinase. 336
  • Domain: Protein kinase
LFELILME2.7.11.1;Non-specific serine/threonine protein kinase. 357
  • Domain: Protein kinase
PEAKSLL2.7.11.1;Non-specific serine/threonine protein kinase. 374
  • Domain: Protein kinase
AKSLLSGLL2.7.11.1;Non-specific serine/threonine protein kinase. 376
  • Domain: Protein kinase
GLLKKDPKQRLGGG2.7.11.1;Non-specific serine/threonine protein kinase. 382
  • Domain: Protein kinase
DAKEIMQH2.7.11.1;Non-specific serine/threonine protein kinase. 398
  • Domain: Protein kinase
PPFKPQVTSE2.7.11.1;Non-specific serine/threonine protein kinase. 423
  • Domain: AGC-kinase C-termina
HFPQFSYSAS2.7.11.1;Non-specific serine/threonine protein kinase. 468
  • Domain: AGC-kinase C-termina

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MSDVAIVKEGWLHKRGEYIKTWRPRYFLLKNDGTFIGYKERPQDVDQREAPLNNFSVAQCQLMKTERPRPNTFIIRCLQWTTVIERTFHVETPEEREEWT
TAIQTVADGLKKQEEEEMDFRSGSPSDNSGAEEMEVSLAKPKHRVTMNEFE
YLKLLGKGTFGKVILVKEKATGRYYAMKILKKEVIVAKDEVAHTLTENR
VLQNSR
HPFLTALKYSFQTHDRLCFVMEYANGGELFFHLSRERVFSEDRARFYGAEIVSALDYLHSEKNVVYRDLKLENLMLDKDGHIKITDFGLCKEGI
KDGATMKTFC
GTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILMEEIRFPRTLGPEAKSLLSGLLKKDPKQRLGGGSEDAK
EIMQH
RFFAGIVWQHVYEKKLSPPFKPQVTSETDTRYFDEEFTAQMITITPPDQDDSMECVDSERRPHFPQFSYSASGTA



DME EC Prediction for this protein is: 2.7.11.1
Check another protein