Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data

Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
DTLHHKA1.14.13.39;Nitric-oxide synthase. 98
  • Gene: NOS2
KSLTRGPRDKPTP1.14.13.39;Nitric-oxide synthase. 123
  • Gene: NOS2
ELLPQAIEF1.14.13.39;Nitric-oxide synthase. 138
  • Gene: NOS2
SFKEAKIEE1.14.13.39;Nitric-oxide synthase. 153
  • Gene: NOS2
VTKEIETTGTY1.14.13.39;Nitric-oxide synthase. 169
  • Gene: NOS2
AWRNAPRC1.14.13.39;Nitric-oxide synthase. 193 -
LQVFDAR1.14.13.39;Nitric-oxide synthase. 209 -
EMFEHICRH1.14.13.39;Nitric-oxide synthase. 222
  • Gene: NOS2
GNIRSAIT1.14.13.39;Nitric-oxide synthase. 238 -
RSAITVFPQR1.14.13.39;Nitric-oxide synthase. 241 -
DGKHDFR1.14.13.39;Nitric-oxide synthase. 252 -
QLIRYAGY1.14.13.39;Nitric-oxide synthase. 263 -
GDPANVE1.14.13.39;Nitric-oxide synthase. 279 -
EFTQLCIDLGWKP1.14.13.39;Nitric-oxide synthase. 285
  • Gene: NOS2
FEIPPDLVLEV1.14.13.39;Nitric-oxide synthase. 319
  • Gene: NOS2
MEHPKYEWF1.14.13.39;Nitric-oxide synthase. 331
  • Gene: NOS2
LKWYALP1.14.13.39;Nitric-oxide synthase. 344 -
PFNGWYM1.14.13.39;Nitric-oxide synthase. 368 -
GWYMGTE1.14.13.39;Nitric-oxide synthase. 371
  • Binding Site Y=Tyrosine at location 373 on the protein
  • Binding site description: Substrate.
EVGRRMGLE1.14.13.39;Nitric-oxide synthase. 394
  • Gene: NOS2
VEINIAVL1.14.13.39;Nitric-oxide synthase. 416 -
AVLHSFQKQNVTIMDHH1.14.13.39;Nitric-oxide synthase. 421
  • Gene: NOS2
DHHSAAESFMK1.14.13.39;Nitric-oxide synthase. 435 -
RGGCPADW1.14.13.39;Nitric-oxide synthase. 454 -
TPVFHQEM1.14.13.39;Nitric-oxide synthase. 473 -
WKTHVWQDE1.14.13.39;Nitric-oxide synthase. 496
  • Gene: NOS2
ATETGKS1.14.13.39;Nitric-oxide synthase. 544
  • Domain: Flavodoxin-like
VVTSTFGNGD1.14.13.39;Nitric-oxide synthase. 588
  • Domain: Flavodoxin-like
FRYAVFGLGSSMYP1.14.13.39;Nitric-oxide synthase. 619
  • Domain: Flavodoxin-like
  • Gene: NOS2
FCAFAHDID1.14.13.39;Nitric-oxide synthase. 634
  • Domain: Flavodoxin-like
  • Gene: NOS2
SRQNLQSP1.14.13.39;Nitric-oxide synthase. 739
  • Domain: FAD-binding FR-type
QALTYFLDIT1.14.13.39;Nitric-oxide synthase. 826
  • Domain: FAD-binding FR-type
LDITTPP1.14.13.39;Nitric-oxide synthase. 832
  • Domain: FAD-binding FR-type
RQRLEALCQPSEY1.14.13.39;Nitric-oxide synthase. 856
  • Domain: FAD-binding FR-type
  • Gene: NOS2
VLEEFPS1.14.13.39;Nitric-oxide synthase. 882
  • Domain: FAD-binding FR-type
FLLSQLPILKPR1.14.13.39;Nitric-oxide synthase. 895
  • Domain: FAD-binding FR-type
  • Gene: NOS2
EIHLTVA1.14.13.39;Nitric-oxide synthase. 920
  • Domain: FAD-binding FR-type
GPLHHGVCSTW1.14.13.39;Nitric-oxide synthase. 937
  • Domain: FAD-binding FR-type
  • Gene: NOS2
APFRSFWQQR1.14.13.39;Nitric-oxide synthase. 987 -
MTLVFGCR1.14.13.39;Nitric-oxide synthase. 1010 -
YSRLPGKPK1.14.13.39;Nitric-oxide synthase. 1045
  • Gene: NOS2
CGDVRMARDVA1.14.13.39;Nitric-oxide synthase. 1082
  • Gene: NOS2
EEQVEDYFFQLK1.14.13.39;Nitric-oxide synthase. 1107
  • Gene: NOS2

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MACPWKFLFKTKFHQYAMNGEKDINNNVEKAPCATSSPVTQDDLQYHNLSKQQNESPQPLVETGKKSPESLVKLDATPLSSPRHVRIKNWGSGMTFQDTL
HHKAKGILTCRSKSCLGSIMTPKSLTRGPRDKPTPPDELLPQAIEFVNQYYGSFKEAKIEEHLARVEAVTKEIETTGTYQLTGDELIFATKQAWRNAPRC
IGRIQWSNLQVFDARSCSTAREMFEHICRHVRYSTNNGNIRSAITVFPQRSDGKHDFRVWNAQLIRYAGYQMPDGSIRGDPANVEFTQLCIDLGWKPKYG
RFDVVPLVLQANGRDPELFEIPPDLVLEVAMEHPKYEWFRELELKWYALPAVANMLLEVGGLEFPGCPFNGWYMGTEIGVRDFCDVQRYNILEEVGRRMG
LETHKLASLWKDQAVVEINIAVLHSFQKQNVTIMDHHSAAESFMKYMQNEYRSRGGCPADWIWLVPPMSGSITPVFHQEMLNYVLSPFYYYQVEAWKTHV
WQDEKRRPKRREIPLKVLVKAVLFACMLMRKTMASRVRVTILFATETGKSEALAWDLGALFSCAFNPKVVCMDKYRLSCLEEERLLLVVTSTFGNGDCPG
NGEKLKKSLFMLKELNNKFRYAVFGLGSSMYPRFCAFAHDIDQKLSHLGASQLTPMGEGDELSGQEDAFRSWAVQTFKAACETFDVRGKQHIQIPKLYTS
NVTWDPHHYRLVQDSQPLDLSKALSSMHAKNVFTMRLKSRQNLQSPTSSRATILVELSCEDGQGLNYLPGEHLGVCPGNQPALVQGILERVVDGPTPHQT
VRLEALDESGSYWVSDKRLPPCSLSQALTYFLDITTPPTQLLLQKLAQVATEEPERQRLEALCQPSEYSKWKFTNSPTFLEVLEEFPSLRVSAGFLLSQL
PILKPRFYSISSSRDHTPTEIHLTVAVVTYHTRDGQGPLHHGVCSTWLNSLKPQDPVPCFVRNASGFHLPEDPSHPCILIGPGTGIAPFRSFWQQRLHDS
QHKGVRGGRMTLVFGCRRPDEDHIYQEEMLEMAQKGVLHAVHTAYSRLPGKPKVYVQDILRQQLASEVLRVLHKEPGHLYVCGDVRMARDVAHTLKQLVA
AKLKLNEEQVEDYFFQLKSQKRYHEDIFGAVFPYEAKKDRVAVQPSSLEMSAL


DME EC Prediction for this protein is: 1.14.13.39
Check another protein