Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data

Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
PCQNRGVCMSVGFDQY1.14.99.1;Prostaglandin-endoperoxide synthase. 25
  • Domain: EGF-like
  • Gene: PGH2
CDCTRTG1.14.99.1;Prostaglandin-endoperoxide synthase. 42
  • Domain: EGF-like
RTGFYGENC1.14.99.1;Prostaglandin-endoperoxide synthase. 46
  • Domain: EGF-like
  • Gene: PGH2
LKPTPNTVHYILTHFKG1.14.99.1;Prostaglandin-endoperoxide synthase. 67
  • Gene: PGH2
YKSWEAFSNLSYYTRALPPV1.14.99.1;Prostaglandin-endoperoxide synthase. 122
  • Gene: PGH2
FIPDPQG1.14.99.1;Prostaglandin-endoperoxide synthase. 173 -
MFAFFAQHFTHQFFKT1.14.99.1;Prostaglandin-endoperoxide synthase. 183
  • Active Site H=Histidine at location 193 on the protein
  • Active Site Description: Proton acceptor (By similarity
LGHGVDL1.14.99.1;Prostaglandin-endoperoxide synthase. 210 -
LRLFKDGK1.14.99.1;Prostaglandin-endoperoxide synthase. 230 -
RLFKDGK1.14.99;Miscellaneous (requires further characterization). 231 -
RLFKDGKMKYQ1.14.99.1;Prostaglandin-endoperoxide synthase. 231
  • Gene: PGH2
YPPTVKDTQ1.14.99.1;Prostaglandin-endoperoxide synthase. 248
  • Gene: PGH2
VGQEVFGL1.14.99.1;Prostaglandin-endoperoxide synthase. 273 -
WLREHNRVCD1.14.99.1;Prostaglandin-endoperoxide synthase. 291 -
RLILIGETIKI1.14.99.1;Prostaglandin-endoperoxide synthase. 319 -
YVQHLSGY1.14.99.1;Prostaglandin-endoperoxide synthase. 334 -
HLSGYHF1.14.99.1;Prostaglandin-endoperoxide synthase. 337
  • Gene: PGH2
LKFDPELLF1.14.99.1;Prostaglandin-endoperoxide synthase. 345 -
LYHWHPL1.14.99.1;Prostaglandin-endoperoxide synthase. 370
  • Active Site Y=Tyrosine at location 371 on the protein
  • Active Site Description: For cyclooxygenase activity (B
  • Metal Site H=Histidine at location 374 on the protein
  • Metal Site Description: Iron (heme axial ligand) (By s
YNNSILLEHG1.14.99.1;Prostaglandin-endoperoxide synthase. 395
  • Gene: PGH2
AGRVAGG1.14.99.1;Prostaglandin-endoperoxide synthase. 417
  • Gene: PGH2
ASIDQSR1.14.99.1;Prostaglandin-endoperoxide synthase. 436
  • Gene: PGH2
FNEYRKRF1.14.99.1;Prostaglandin-endoperoxide synthase. 449 -
SFEELTGEKEM1.14.99.1;Prostaglandin-endoperoxide synthase. 463
  • Gene: PGH2
LYGDIDA1.14.99.1;Prostaglandin-endoperoxide synthase. 480 -
LLVEKPRP1.14.99.1;Prostaglandin-endoperoxide synthase. 493
  • Gene: PGH2
AIFGETMVE1.14.99.1;Prostaglandin-endoperoxide synthase. 502
  • Gene: PGH2
GAPFSLKGL1.14.99.1;Prostaglandin-endoperoxide synthase. 512 -
YWKPSTFGG1.14.99.1;Prostaglandin-endoperoxide synthase. 530 -
IINTASI1.14.99.1;Prostaglandin-endoperoxide synthase. 544
  • Binding Site S=Serine at location 549 on the protein
  • Binding site description: Substrate (By similarity).

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MLARALLLCAVLALSHTANPCCSHPCQNRGVCMSVGFDQYKCDCTRTGFYGENCSTPEFLTRIKLFLKPTPNTVHYILTHFKGFWNVVNNIPFLRNAIMS
YVLTSRSHLIDSPPTYNADYGYKSWEAFSNLSYYTRALPPVPDDCPTPLGVKGKKQLPDSNEIVEKLLLRRKFIPDPQGSNMMFAFFAQHFTHQFFKTDH
KRGPAFTNGLGHGVDLNHIYGETLARQRKLRLFKDGKMKYQIIDGEMYPPTVKDTQAEMIYPPQVPEHLRFAVGQEVFGLVPGLMMYATIWLREHNRVCD
VLKQEHPEWGDEQLFQTSRLILIGETIKIVIEDYVQHLSGYHFKLKFDPELLFNKQFQYQNRIAAEFNTLYHWHPLLPDTFQIHDQKYNYQQFIYNNSIL
LEHGITQFVESFTRQIAGRVAGGRNVPPAVQKVSQASIDQSRQMKYQSFNEYRKRFMLKPYESFEELTGEKEMSAELEALYGDIDAVELYPALLVEKPRP
DAIFGETMVEVGAPFSLKGLMGNVICSPAYWKPSTFGGEVGFQIINTASIQSLICNNVKGCPFTSFSVPDPELIKTVTINASSSRSGLDDINPTVLLKER
STEL


DME EC Prediction for this protein is: 1.14.99.1
Check another protein