Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
VSLSNQEAVITYQPYLIQP3.6.3.4;Copper-exporting ATPase. 176
  • Domain: HMA
  • Gene: ATP7B
GMHCKSCV3.6.3.4;Copper-exporting ATPase. 265
  • Domain: HMA
GMTCASCV3.6.3;Acting on acid anhydrides; catalyzing transmembrane movement 367
  • Metal Site C=Cysteine at location 370 on the protein
  • Metal Site Description: Copper (Potential).
  • Domain: HMA
QTTDGTP3.6.3;Acting on acid anhydrides; catalyzing transmembrane movement 447 -
GMTCASCV3.6.3;Acting on acid anhydrides; catalyzing transmembrane movement 496
  • Metal Site C=Cysteine at location 499 on the protein
  • Metal Site Description: Copper (Potential).
  • Domain: HMA
ITGMTCA3.6.3;Acting on acid anhydrides; catalyzing transmembrane movement 570
  • Metal Site C=Cysteine at location 575 on the protein
  • Metal Site Description: Copper 1 (By similarity).
  • Domain: HMA
ITGMTCASCVHNIESKL3.6.3.4;Copper-exporting ATPase. 570
  • Domain: HMA
  • Gene: ATP7B
GMTCASCV3.6.3;Acting on acid anhydrides; catalyzing transmembrane movement 572
  • Metal Site C=Cysteine at location 575 on the protein
  • Metal Site Description: Copper (Potential).
  • Domain: HMA
DPEIIGPRDI3.6.3.4;Copper-exporting ATPase. 609
  • Domain: HMA
PNAHHLDHK3.6.3.4;Copper-exporting ATPase. 636
  • Gene: ATP7B
ANMDVLIVLAT3.6.3.4;Copper-exporting ATPase. 727 -
FDTPPMLFVFIALGRWLEH3.6.3.4;Copper-exporting ATPase. 764 -
KTSEALA3.6.3.4;Copper-exporting ATPase. 787 -
SLQATEAT3.6.3.4;Copper-exporting ATPase. 797 -
KVVPGGKFPVDG3.6.3.4;Copper-exporting ATPase. 832 -
TGEAMPV3.6.3;Acting on acid anhydrides; catalyzing transmembrane movement 858 -
KKPGSTVIAGSIN3.6.3.4;Copper-exporting ATPase. 866 -
VWIVIGF3.6.3.4;Copper-exporting ATPase. 938 -
IIRFAFQ3.6.3.4;Copper-exporting ATPase. 967 -
SITVLCIACPCSLGLATPTAVMVGTGV3.6.3.4;Copper-exporting ATPase. 975 -
GILIKGG3.6.3.4;Copper-exporting ATPase. 1006 -
DKTGTIT3.6.3;Acting on acid anhydrides; catalyzing transmembrane movement 1027
  • Active Site D=Aspartic acid at location 1027 on the protein
  • Active Site Description: 4-aspartylphosphate intermedia
YCKEELGTETLG3.6.3.4;Copper-exporting ATPase. 1078
  • Gene: ATP7B
VLIGNREW3.6.3.4;Copper-exporting ATPase. 1146 -
KGQTAILVAIDGVLCGMIA3.6.3.4;Copper-exporting ATPase. 1175
  • Gene: ATP7B
KVFAEVLPSHKVAKV3.6.3.4;Copper-exporting ATPase. 1238 -
VAMVGDG3.6.3;Acting on acid anhydrides; catalyzing transmembrane movement 1262
  • Metal Site D=Aspartic acid at location 1267 on the protein
  • Metal Site Description: Magnesium (By similarity).
PALAQAD3.6.3;Acting on acid anhydrides; catalyzing transmembrane movement 1273 -
GTDVAIE3.6.3.4;Copper-exporting ATPase. 1287 -
VAIEAAD3.6.3;Acting on acid anhydrides; catalyzing transmembrane movement 1290 -
IRNDLLDVVASI3.6.3.4;Copper-exporting ATPase. 1300 -
SSVSVVLSSL3.6.3.4;Copper-exporting ATPase. 1362 -

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MPEQERQITAREGASRKILSKLSLPTRAWEPAMKKSFAFDNVGYEGGLDGLGPSSQVATSTVRILGMTCQSCVKSIEDRISNLKGIISMKVSLEQGSATV
KYVPSVVCLQQVCHQIGDMGFEASIAEGKAASWPSRSLPAQEAVVKLRVEGMTCQSCVSSIEGKVRKLQGVVRVK
VSLSNQEAVITYQPYLIQPEDLRDH
VNDMGFEAAIKSKVAPLSLGPIDIERLQSTNPKRPLSSANQNFNNSETLGHQGSHVVTLQLRID
GMHCKSCVLNIEENIGQLLGVQSIQVSLENKTAQVK
YDPSCTSPVALQRAIEALPPGNFKVSLPDGAEGSGTDHRSSSSHSPGSPPRNQVQGTCSTTLIAIA
GMTCASCVHSIEGMISQLEGVQQISVSLAEGTAT
VLYNPSVISPEELRAAIEDMGFEASVVSESCSTNPLGNHSAGNSMV
QTTDGTPTSVQEVAPHTGRLPANHAPDILAKSPQSTRAVAPQKCFLQIKGMTCA
SCV
SNIERNLQKEAGVLSVLVALMAGKAEIKYDPEVIQPLEIAQFIQDLGFEAAVMEDYAGSDGNIELTITGMTCASCVHNIESKLTRTNGITYASVALA
TSKALVKF
DPEIIGPRDIIKIIEEIGFHASLAQRNPNAHHLDHKMEIKQWKKSFLCSLVFGIPVMALMIYMLIPSNEPHQSMVLDHNIIPGLSILNLIFF
ILCTFVQLLGGWYFYVQAYKSLRHRS
ANMDVLIVLATSIAYVYSLVILVVAVAEKAERSPVTFFDTPPMLFVFIALGRWLEHLAKSKTSEALAKLMSLQA
TEAT
VVTLGEDNLIIREEQVPMELVQRGDIVKVVPGGKFPVDGKVLEGNTMADESLITGEAMPVTKKPGSTVIAGSINAHGSVLIKATHVGNDTTLAQIV
KLVEEAQMSKAPIQQLADRFSGYFVPFIIIMSTLTLV
VWIVIGFIDFGVVQRYFPNPNKHISQTEVIIRFAFQTSITVLCIACPCSLGLATPTAVMVGTG
V
AAQNGILIKGGKPLEMAHKIKTVMFDKTGTITHGVPRVMRVLLLGDVATLPLRKVLAVVGTAEASSEHPLGVAVTKYCKEELGTETLGYCTDFQAVPGC
GIGCKVSNVEGILAHSERPLSAPASHLNEAGSLPAEKDAVPQTFS
VLIGNREWLRRNGLTISSDVSDAMTDHEMKGQTAILVAIDGVLCGMIAIADAVKQ
EAALAVHTLQSMGVDVVLITGDNRKTARAIATQVGIN
KVFAEVLPSHKVAKVQELQNKGKKVAMVGDGVNDSPALAQADMGVAIGTGTDVAIEAADVVLI
RNDLLDVVASI
HLSKRTVRRIRINLVLALIYNLVGIPIAAGVFMPIGIVLQPWMGSAAMAASSVSVVLSSLQLKCYKKPDLERYEAQAHGHMKPLTASQV
SVHIGMDDRWRDSPRATPWDQVSYVSQVSLSSLTSDKPSRHSAAADDDGDKWSLLLNGRDEEQYI



DME EC Prediction for this protein is: 3.6.3.4
Check another protein