Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
VAVKMLK2.7.10.1;Receptor protein-tyrosine kinase. 641
  • Binding Site K=Lysine at location 644 on the protein
  • Binding site description: ATP (By similarity).
  • Domain: Protein kinase
ALMSELK2.7.10.1;Receptor protein-tyrosine kinase. 657
  • Domain: Protein kinase
NIVNLLGACT2.7.10.1;Receptor protein-tyrosine kinase. 673
  • Domain: Protein kinase
EYCCYGDLLN2.7.10.1;Receptor protein-tyrosine kinase. 692
  • Domain: Protein kinase
RDLAARN2.7.10;Protein-tyrosine kinases. 810
  • Active Site D=Aspartic acid at location 811 on the protein
  • Active Site Description: Proton acceptor (By similarity
  • Domain: Protein kinase
AARNVLV2.7.10;Protein-tyrosine kinases. 813
  • Domain: Protein kinase
KICDFGLARD2.7.10.1;Receptor protein-tyrosine kinase. 826
  • Domain: Protein kinase
DFGLARDI2.7.10.1;Receptor protein-tyrosine kinase. 829
  • Domain: Protein kinase
LPVKWMA2.7.10.1;Receptor protein-tyrosine kinase. 850
  • Domain: Protein kinase
PVKWMAPE2.7.10.1;Receptor protein-tyrosine kinase. 851
  • Domain: Protein kinase
SDVWSYGI2.7.10;Protein-tyrosine kinases. 869
  • Domain: Protein kinase
GILLWEIF2.7.10.1;Receptor protein-tyrosine kinase. 875
  • Domain: Protein kinase
WEIFSLG2.7.10.1;Receptor protein-tyrosine kinase. 879
  • Domain: Protein kinase

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MPALARDGGQLPLLVVFSAMIFGTITNQDLPVIKCVLINHKNNDSSVGKSSSYPMVSESPEDLGCALRPQSSGTVYEAAAVEVDVSASITLQVLVDAPGN
ISCLWVFKHSSLNCQPHFDLQNRGVVSMVILKMTETQAGEYLLFIQSEATNYTILFTVSIRNTLLYTLRRPYFRKMENQDALVCISESVPEPIVEWVLCD
SQGESCKEESPAVVKKEEKVLHELFGTDIRCCARNELGRECTRLFTIDLNQTPQTTLPQLFLKVGEPLWIRCKAVHVNHGFGLTWELENKALEEGNYFEM
STYSTNRTMIRILFAFVSSVARNDTGYYTCSSSKHPSQSALVTIVEKGFINATNSSEDYEIDQYEEFCFSVRFKAYPQIRCTWTFSRKSFPCEQKGLDNG
YSISKFCNHKHQPGEYIFHAENDDAQFTKMFTLNIRRKPQVLAEASASQASCFSDGYPLPSWTWKKCSDKSPNCTEEITEGVWNRKANRKVFGQWVSSST
LNMSEAIKGFLVKCCAYNSLGTSCETILLNSPGPFPFIQDNISFYATIGVCLLFIVVLTLLICHKYKKQFRYESQLQMVQVTGSSDNEYFYVDFREYEYD
LKWEFPRENLEFGKVLGSGAFGKVMNATAYGISKTGVSIQ
VAVKMLKEKADSSEREALMSELKMMTQLGSHENIVNLLGACTLSGPIYLIFEYCCYGDLL
N
YLRSKREKFHRTWTEIFKEHNFSFYPTFQSHPNSSMPGSREVQIHPDSDQISGLHGNSFHSEDEIEYENQKRLEEEEDLNVLTFEDLLCFAYQVAKGME
FLEFKSCVH
RDLAARNVLVTHGKVVKICDFGLARDIMSDSNYVVRGNARLPVKWMAPESLFEGIYTIKSDVWSYGILLWEIFSLGVNPYPGIPVDANFYK
LIQNGFKMDQPFYATEEIYIIMQSCWAFDSRKRPSFPNLTSFLGCQLADAEEAMYQNVDGRVSECPHTYQNRRPFSREMDLGLLSPQAQVEDS



DME EC Prediction for this protein is: 2.7.10.1
Check another protein