Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
TDGLCFVSVTETTDKVIHNSMCIAEIDLIPRDRPFVCAP2.7.11.30;Receptor protein serine/threonine kinase. 50
  • Gene: TGFR1
GLGPVELAAVIAGPVCFVCI2.7.11.30;Receptor protein serine/threonine kinase. 120
  • Gene: TGFR1
TLKDLIYD2.7.11.30;Receptor protein serine/threonine kinase. 176
  • Domain: GS
SGSGSGLP2.7.11.30;Receptor protein serine/threonine kinase. 187
  • Domain: GS
PLLVQRTIA2.7.11.30;Receptor protein serine/threonine kinase. 194
  • Domain: GS
ARTIVLQE2.7.11.30;Receptor protein serine/threonine kinase. 202
  • Domain: GS
IGKGRFGEVWRG2.7.11.30;Receptor protein serine/threonine kinase. 211
  • Domain: Protein kinase
VAVKIFSSR2.7.11.30;Receptor protein serine/threonine kinase. 229
  • Binding Site K=Lysine at location 232 on the protein
  • Binding site description: ATP (By similarity).
  • Domain: Protein kinase
RHENILGFIAAD2.7.11.30;Receptor protein serine/threonine kinase. 255
  • Domain: Protein kinase
GMIKLALS2.7.11.30;Receptor protein serine/threonine kinase. 301
  • Domain: Protein kinase
ASGLAHLH2.7.11.30;Receptor protein serine/threonine kinase. 310
  • Domain: Protein kinase
KPAIAHRD2.7.11.30;Receptor protein serine/threonine kinase. 326
  • Domain: Protein kinase
HRDLKSKNILVKKNG2.7.11.30;Receptor protein serine/threonine kinase. 331
  • Active Site D=Aspartic acid at location 333 on the protein
  • Active Site Description: Proton acceptor (By similarity
  • Domain: Protein kinase
CCIADLGLA2.7.11.30;Receptor protein serine/threonine kinase. 347
  • Domain: Protein kinase
IADLGLA2.7.11;Protein-serine/threonine kinases. 349
  • Domain: Protein kinase
IADLGLAVRHD2.7.11.30;Receptor protein serine/threonine kinase. 349
  • Domain: Protein kinase
TDTIDIAPN2.7.11.30;Receptor protein serine/threonine kinase. 362
  • Domain: Protein kinase
RVGTKRYM2.7.11.30;Receptor protein serine/threonine kinase. 372
  • Domain: Protein kinase
RYMAPEVL2.7.11.30;Receptor protein serine/threonine kinase. 377
  • Domain: Protein kinase
YMAPEVL2.7.11;Protein-serine/threonine kinases. 378
  • Domain: Protein kinase
FESFKRADIY2.7.11.30;Receptor protein serine/threonine kinase. 393
  • Domain: Protein kinase
RPNIPNRW2.7.11.30;Receptor protein serine/threonine kinase. 451
  • Domain: Protein kinase
MRECWYANGAARLTALRIKKTLSQLS2.7.11.30;Receptor protein serine/threonine kinase. 471
  • Domain: Protein kinase

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MEAAVAAPRPRLLLLVLAAAAAAAAALLPGATALQCFCHLCTKDNFTCVTDGLCFVSVTETTDKVIHNSMCIAEIDLIPRDRPFVCAPSSKTGSVTTTYC
CNQDHCNKIELPTTVKSSP
GLGPVELAAVIAGPVCFVCISLMLMVYICHNRTVIHHRVPNEEDPSLDRPFISEGTTLKDLIYDMTTSGSGSGLPLLVQRT
IARTIVLQE
SIGKGRFGEVWRGKWRGEEVAVKIFSSREERSWFREAEIYQTVMLRHENILGFIAADNKDNGTWTQLWLVSDYHEHGSLFDYLNRYTVTVE
GMIKLALSTASGLAHLHMEIVGTQGKPAIAHRDLKSKNILVKKNGTCCIADLGLAVRHDSATDTIDIAPNHRVGTKRYMAPEVLDDSINMKHFESFKRAD
IY
AMGLVFWEIARRCSIGGIHEDYQLPYYDLVPSDPSVEEMRKVVCEQKLRPNIPNRWQSCEALRVMAKIMRECWYANGAARLTALRIKKTLSQLSQQEG
IKM



DME EC Prediction for this protein is: 2.7.11.30
Check another protein