Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
CPICLEL6.3.2;Acid--D-amino-acid ligases (peptide synthases). 24 -
ITKRSLQ6.3.2;Acid--D-amino-acid ligases (peptide synthases). 68
  • Gene: BRCA1
RFSQLVEELLKII6.3.2;Acid--D-amino-acid ligases (peptide synthases). 78
  • Gene: BRCA1
ANSYNFAKKEN6.3.2;Acid--D-amino-acid ligases (peptide synthases). 102
  • Gene: BRCA1
EVSIIQSMGYRNRAKRL6.3.2;Acid--D-amino-acid ligases (peptide synthases). 121
  • Gene: BRCA1
RAKRLLQSEPENPSLQET6.3.2;Acid--D-amino-acid ligases (peptide synthases). 133
  • Gene: BRCA1
SLDSAKKAACEFSE6.3.2;Acid--D-amino-acid ligases (peptide synthases). 217
  • Gene: BRCA1
SNNDLNTTEK6.3.2;Acid--D-amino-acid ligases (peptide synthases). 242
  • Gene: BRCA1
THASSLQHENSSLLLT6.3.2;Acid--D-amino-acid ligases (peptide synthases). 278
  • Gene: BRCA1
RMNVEKAE6.3.2;Acid--D-amino-acid ligases (peptide synthases). 296
  • Gene: BRCA1
NVEKAEFCNKSKQP6.3.2;Acid--D-amino-acid ligases (peptide synthases). 298
  • Gene: BRCA1
TPSTEKKVDLNA6.3.2;Acid--D-amino-acid ligases (peptide synthases). 333
  • Gene: BRCA1
DVPWITLNSS6.3.2;Acid--D-amino-acid ligases (peptide synthases). 369
  • Gene: BRCA1
YSGSSEKI6.3.2;Acid--D-amino-acid ligases (peptide synthases). 422
  • Gene: BRCA1
LICKSERVHS6.3.2;Acid--D-amino-acid ligases (peptide synthases). 440
  • Gene: BRCA1
TNKLKRKR6.3.2;Acid--D-amino-acid ligases (peptide synthases). 499
  • Gene: BRCA1
TSGLHPEDFIKKADLAVQKTPE6.3.2;Acid--D-amino-acid ligases (peptide synthases). 509
  • Gene: BRCA1
HENKTKGDSIQNEKNPN6.3.2;Acid--D-amino-acid ligases (peptide synthases). 553
  • Gene: BRCA1
SKAPKKNRLRRKS6.3.2;Acid--D-amino-acid ligases (peptide synthases). 603
  • Gene: BRCA1
LELVVSRN6.3.2;Acid--D-amino-acid ligases (peptide synthases). 623
  • Gene: BRCA1
ELQIDSC6.3.2;Acid--D-amino-acid ligases (peptide synthases). 638
  • Gene: BRCA1
LQTERSVES6.3.2;Acid--D-amino-acid ligases (peptide synthases). 758
  • Gene: BRCA1
TDYGTQESISLLEVSTLGKAKTE6.3.2;Acid--D-amino-acid ligases (peptide synthases). 775
  • Gene: BRCA1
SQCAAFENPK6.3.2;Acid--D-amino-acid ligases (peptide synthases). 803
  • Gene: BRCA1
ETSIEMEESELD6.3.2;Acid--D-amino-acid ligases (peptide synthases). 842
  • Gene: BRCA1
ECEQKEENQGK6.3.2;Acid--D-amino-acid ligases (peptide synthases). 902
  • Gene: BRCA1
AKCSIKG6.3.2;Acid--D-amino-acid ligases (peptide synthases). 942
  • Gene: BRCA1
KSFVKTKC6.3.2;Acid--D-amino-acid ligases (peptide synthases). 987
  • Gene: BRCA1
EEHSMSPEREMGNENIPSTVS6.3.2;Acid--D-amino-acid ligases (peptide synthases). 1004
  • Gene: BRCA1
RGPKLNAMLRLGVLQPEVYKQS6.3.2;Acid--D-amino-acid ligases (peptide synthases). 1076
  • Gene: BRCA1
NDIKESSAVFSK6.3.2;Acid--D-amino-acid ligases (peptide synthases). 1168
  • Gene: BRCA1
PFTHTHLAQG6.3.2;Acid--D-amino-acid ligases (peptide synthases). 1192
  • Gene: BRCA1
TRHSTVATECLSKNTEENLLSLKNSL6.3.2;Acid--D-amino-acid ligases (peptide synthases). 1242
  • Gene: BRCA1
SLFSSQCS6.3.2;Acid--D-amino-acid ligases (peptide synthases). 1294
  • Gene: BRCA1
DKELVSDD6.3.2;Acid--D-amino-acid ligases (peptide synthases). 1337
  • Gene: BRCA1
LEENNQEEQ6.3.2;Acid--D-amino-acid ligases (peptide synthases). 1351
  • Gene: BRCA1
ESETSVSEDCS6.3.2;Acid--D-amino-acid ligases (peptide synthases). 1373
  • Gene: BRCA1
SQSDILTTQQR6.3.2;Acid--D-amino-acid ligases (peptide synthases). 1387
  • Gene: BRCA1
LEAVLEQHGSQPS6.3.2;Acid--D-amino-acid ligases (peptide synthases). 1414
  • Gene: BRCA1
PISQNPE6.3.2;Acid--D-amino-acid ligases (peptide synthases). 1464
  • Gene: BRCA1
KNKEPGVERSSPSKCPSLDDRWYMHSCSGSLQN6.3.2;Acid--D-amino-acid ligases (peptide synthases). 1487
  • Gene: BRCA1
NYPSQEELIKVVDVE6.3.2;Acid--D-amino-acid ligases (peptide synthases). 1521
  • Gene: BRCA1
QQLEESGPHDLTE6.3.2;Acid--D-amino-acid ligases (peptide synthases). 1537
  • Gene: BRCA1
IPSSTSALKVPQ6.3.2;Acid--D-amino-acid ligases (peptide synthases). 1593
  • Gene: BRCA1
LTASTERVNKRMS6.3.2;Acid--D-amino-acid ligases (peptide synthases). 1639
  • Gene: BRCA1
VVSGLTPEEFMLVYKFAR6.3.2;Acid--D-amino-acid ligases (peptide synthases). 1653
  • Domain: BRCT
  • Gene: BRCA1
KFARKHH6.3.2;Acid--D-amino-acid ligases (peptide synthases). 1667
  • Domain: BRCT
  • Gene: BRCA1
EFVCERTLKYFLGIAGGKWVVSYFWVTQSIKE6.3.2;Acid--D-amino-acid ligases (peptide synthases). 1694
  • Domain: BRCT
  • Gene: BRCA1
GRNHQGP6.3.2;Acid--D-amino-acid ligases (peptide synthases). 1743
  • Gene: BRCA1
VVVQPDAWTED6.3.2;Acid--D-amino-acid ligases (peptide synthases). 1808
  • Domain: BRCT
  • Gene: BRCA1
IGQMCEAPVVTREWVLDSVALYQCQELDTYL6.3.2;Acid--D-amino-acid ligases (peptide synthases). 1824
  • Domain: BRCT
  • Gene: BRCA1

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MDLSALRVEEVQNVINAMQKILECPICLELIKEPVSTKCDHIFCKFCMLKLLNQKKGPSQCPLCKNDITKRSLQESTRFSQLVEELLKIICAFQLDTGLE
Y
ANSYNFAKKENNSPEHLKDEVSIIQSMGYRNRAKRLLQSEPENPSLQETSLSVQLSNLGTVRTLRTKQRIQPQKTSVYIELGSDSSEDTVNKATYCSVG
DQELLQITPQGTRDEI
SLDSAKKAACEFSETDVTNTEHHQPSNNDLNTTEKRAAERHPEKYQGSSVSNLHVEPCGTNTHASSLQHENSSLLLTKDRMNVE
KAEFCNKSKQP
GLARSQHNRWAGSKETCNDRRTPSTEKKVDLNADPLCERKEWNKQKLPCSENPRDTEDVPWITLNSSIQKVNEWFSRSDELLGSDDSHD
GESESNAKVADVLDVLNEVDE
YSGSSEKIDLLASDPHEALICKSERVHSKSVESNIEDKIFGKTYRKKASLPNLSHVTENLIIGAFVTEPQIIQERPLTN
KLKRKR
RPTSGLHPEDFIKKADLAVQKTPEMINQGTNQTEQNGQVMNITNSGHENKTKGDSIQNEKNPNPIESLEKESAFKTKAEPISSSISNMELELNI
HN
SKAPKKNRLRRKSSTRHIHALELVVSRNLSPPNCTELQIDSCSSSEEIKKKKYNQMPVRHSRNLQLMEGKEPATGAKKSNKPNEQTSKRHDSDTFPEL
KLTNAPGSFTKCSNTSELKEFVNPSLPREEKEEKLETVKVSNNAEDPKDLMLSGERV
LQTERSVESSSISLVPGTDYGTQESISLLEVSTLGKAKTEPNK
CV
SQCAAFENPKGLIHGCSKDNRNDTEGFKYPLGHEVNHSRETSIEMEESELDAQYLQNTFKVSKRQSFAPFSNPGNAEEECATFSAHSGSLKKQSPKVT
F
ECEQKEENQGKNESNIKPVQTVNITAGFPVVGQKDKPVDNAKCSIKGGSRFCLSSQFRGNETGLITPNKHGLLQNPYRIPPLFPIKSFVKTKCKKNLLE
ENF
EEHSMSPEREMGNENIPSTVSTISRNNIRENVFKEASSSNINEVGSSTNEVGSSINEIGSSDENIQAELGRNRGPKLNAMLRLGVLQPEVYKQSLPG
SNCKHPEIKKQEYEEVVQTVNTDFSPYLISDNLEQPMGSSHASQVCSETPDDLLDDGEIKEDTSFAE
NDIKESSAVFSKSVQKGELSRSPSPFTHTHLAQ
G
YRRGAKKLESSEENLSSEDEELPCFQHLLFGKVNNIPSQSTRHSTVATECLSKNTEENLLSLKNSLNDCSNQVILAKASQEHHLSEETKCSASLFSSQC
S
ELEDLTANTNTQDPFLIGSSKQMRHQSESQGVGLSDKELVSDDEERGTGLEENNQEEQSMDSNLGEAASGCESETSVSEDCSGLSSQSDILTTQQRDTM
QHNLIKLQQEMAE
LEAVLEQHGSQPSNSYPSIISDSSALEDLRNPEQSTSEKAVLTSQKSSEYPISQNPEGLSADKFEVSADSSTSKNKEPGVERSSPSK
CPSLDDRWYMHSCSGSLQN
RNYPSQEELIKVVDVEEQQLEESGPHDLTETSYLPRQDLEGTPYLESGISLFSDDPESDPSEDRAPESARVGNIPSSTSAL
KVPQ
LKVAESAQSPAAAHTTDTAGYNAMEESVSREKPELTASTERVNKRMSMVVSGLTPEEFMLVYKFARKHHITLTNLITEETTHVVMKTDAEFVCERT
LKYFLGIAGGKWVVSYFWVTQSIKE
RKMLNEHDFEVRGDVVNGRNHQGPKRARESQDRKIFRGLEICCYGPFTNMPTDQLEWMVQLCGASVVKELSSFTL
GTGVHPI
VVVQPDAWTEDNGFHAIGQMCEAPVVTREWVLDSVALYQCQELDTYLIPQIPHSHY



DME EC Prediction for this protein is: 6.3.2
Check another protein