Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data

Specific Peptide	EC	Function	Location of SP in Protein	Predicted Features
CPICLEL	6.3.2;	Acid--D-amino-acid ligases (peptide synthases).	24	-
ITKRSLQ	6.3.2;	Acid--D-amino-acid ligases (peptide synthases).	68	Gene: BRCA1
RFSQLVEELLKII	6.3.2;	Acid--D-amino-acid ligases (peptide synthases).	78	Gene: BRCA1
ANSYNFAKKEN	6.3.2;	Acid--D-amino-acid ligases (peptide synthases).	102	Gene: BRCA1
EVSIIQSMGYRNRAKRL	6.3.2;	Acid--D-amino-acid ligases (peptide synthases).	121	Gene: BRCA1
RAKRLLQSEPENPSLQET	6.3.2;	Acid--D-amino-acid ligases (peptide synthases).	133	Gene: BRCA1
SLDSAKKAACEFSE	6.3.2;	Acid--D-amino-acid ligases (peptide synthases).	217	Gene: BRCA1
SNNDLNTTEK	6.3.2;	Acid--D-amino-acid ligases (peptide synthases).	242	Gene: BRCA1
THASSLQHENSSLLLT	6.3.2;	Acid--D-amino-acid ligases (peptide synthases).	278	Gene: BRCA1
RMNVEKAE	6.3.2;	Acid--D-amino-acid ligases (peptide synthases).	296	Gene: BRCA1
NVEKAEFCNKSKQP	6.3.2;	Acid--D-amino-acid ligases (peptide synthases).	298	Gene: BRCA1
TPSTEKKVDLNA	6.3.2;	Acid--D-amino-acid ligases (peptide synthases).	333	Gene: BRCA1
DVPWITLNSS	6.3.2;	Acid--D-amino-acid ligases (peptide synthases).	369	Gene: BRCA1
YSGSSEKI	6.3.2;	Acid--D-amino-acid ligases (peptide synthases).	422	Gene: BRCA1
LICKSERVHS	6.3.2;	Acid--D-amino-acid ligases (peptide synthases).	440	Gene: BRCA1
TNKLKRKR	6.3.2;	Acid--D-amino-acid ligases (peptide synthases).	499	Gene: BRCA1
TSGLHPEDFIKKADLAVQKTPE	6.3.2;	Acid--D-amino-acid ligases (peptide synthases).	509	Gene: BRCA1
HENKTKGDSIQNEKNPN	6.3.2;	Acid--D-amino-acid ligases (peptide synthases).	553	Gene: BRCA1
SKAPKKNRLRRKS	6.3.2;	Acid--D-amino-acid ligases (peptide synthases).	603	Gene: BRCA1
LELVVSRN	6.3.2;	Acid--D-amino-acid ligases (peptide synthases).	623	Gene: BRCA1
ELQIDSC	6.3.2;	Acid--D-amino-acid ligases (peptide synthases).	638	Gene: BRCA1
LQTERSVES	6.3.2;	Acid--D-amino-acid ligases (peptide synthases).	758	Gene: BRCA1
TDYGTQESISLLEVSTLGKAKTE	6.3.2;	Acid--D-amino-acid ligases (peptide synthases).	775	Gene: BRCA1
SQCAAFENPK	6.3.2;	Acid--D-amino-acid ligases (peptide synthases).	803	Gene: BRCA1
ETSIEMEESELD	6.3.2;	Acid--D-amino-acid ligases (peptide synthases).	842	Gene: BRCA1
ECEQKEENQGK	6.3.2;	Acid--D-amino-acid ligases (peptide synthases).	902	Gene: BRCA1
AKCSIKG	6.3.2;	Acid--D-amino-acid ligases (peptide synthases).	942	Gene: BRCA1
KSFVKTKC	6.3.2;	Acid--D-amino-acid ligases (peptide synthases).	987	Gene: BRCA1
EEHSMSPEREMGNENIPSTVS	6.3.2;	Acid--D-amino-acid ligases (peptide synthases).	1004	Gene: BRCA1
RGPKLNAMLRLGVLQPEVYKQS	6.3.2;	Acid--D-amino-acid ligases (peptide synthases).	1076	Gene: BRCA1
NDIKESSAVFSK	6.3.2;	Acid--D-amino-acid ligases (peptide synthases).	1168	Gene: BRCA1
PFTHTHLAQG	6.3.2;	Acid--D-amino-acid ligases (peptide synthases).	1192	Gene: BRCA1
TRHSTVATECLSKNTEENLLSLKNSL	6.3.2;	Acid--D-amino-acid ligases (peptide synthases).	1242	Gene: BRCA1
SLFSSQCS	6.3.2;	Acid--D-amino-acid ligases (peptide synthases).	1294	Gene: BRCA1
DKELVSDD	6.3.2;	Acid--D-amino-acid ligases (peptide synthases).	1337	Gene: BRCA1
LEENNQEEQ	6.3.2;	Acid--D-amino-acid ligases (peptide synthases).	1351	Gene: BRCA1
ESETSVSEDCS	6.3.2;	Acid--D-amino-acid ligases (peptide synthases).	1373	Gene: BRCA1
SQSDILTTQQR	6.3.2;	Acid--D-amino-acid ligases (peptide synthases).	1387	Gene: BRCA1
LEAVLEQHGSQPS	6.3.2;	Acid--D-amino-acid ligases (peptide synthases).	1414	Gene: BRCA1
PISQNPE	6.3.2;	Acid--D-amino-acid ligases (peptide synthases).	1464	Gene: BRCA1
KNKEPGVERSSPSKCPSLDDRWYMHSCSGSLQN	6.3.2;	Acid--D-amino-acid ligases (peptide synthases).	1487	Gene: BRCA1
NYPSQEELIKVVDVE	6.3.2;	Acid--D-amino-acid ligases (peptide synthases).	1521	Gene: BRCA1
QQLEESGPHDLTE	6.3.2;	Acid--D-amino-acid ligases (peptide synthases).	1537	Gene: BRCA1
IPSSTSALKVPQ	6.3.2;	Acid--D-amino-acid ligases (peptide synthases).	1593	Gene: BRCA1
LTASTERVNKRMS	6.3.2;	Acid--D-amino-acid ligases (peptide synthases).	1639	Gene: BRCA1
VVSGLTPEEFMLVYKFAR	6.3.2;	Acid--D-amino-acid ligases (peptide synthases).	1653	Domain: BRCT Gene: BRCA1
KFARKHH	6.3.2;	Acid--D-amino-acid ligases (peptide synthases).	1667	Domain: BRCT Gene: BRCA1
EFVCERTLKYFLGIAGGKWVVSYFWVTQSIKE	6.3.2;	Acid--D-amino-acid ligases (peptide synthases).	1694	Domain: BRCT Gene: BRCA1
GRNHQGP	6.3.2;	Acid--D-amino-acid ligases (peptide synthases).	1743	Gene: BRCA1
VVVQPDAWTED	6.3.2;	Acid--D-amino-acid ligases (peptide synthases).	1808	Domain: BRCT Gene: BRCA1
IGQMCEAPVVTREWVLDSVALYQCQELDTYL	6.3.2;	Acid--D-amino-acid ligases (peptide synthases).	1824	Domain: BRCT Gene: BRCA1

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MDLSALRVEEVQNVINAMQKILECPICLELIKEPVSTKCDHIFCKFCMLKLLNQKKGPSQCPLCKNDITKRSLQESTRFSQLVEELLKIICAFQLDTGLE
YANSYNFAKKENNSPEHLKDEVSIIQSMGYRNRAKRLLQSEPENPSLQETSLSVQLSNLGTVRTLRTKQRIQPQKTSVYIELGSDSSEDTVNKATYCSVG
DQELLQITPQGTRDEISLDSAKKAACEFSETDVTNTEHHQPSNNDLNTTEKRAAERHPEKYQGSSVSNLHVEPCGTNTHASSLQHENSSLLLTKDRMNVE
KAEFCNKSKQPGLARSQHNRWAGSKETCNDRRTPSTEKKVDLNADPLCERKEWNKQKLPCSENPRDTEDVPWITLNSSIQKVNEWFSRSDELLGSDDSHD
GESESNAKVADVLDVLNEVDEYSGSSEKIDLLASDPHEALICKSERVHSKSVESNIEDKIFGKTYRKKASLPNLSHVTENLIIGAFVTEPQIIQERPLTN
KLKRKRRPTSGLHPEDFIKKADLAVQKTPEMINQGTNQTEQNGQVMNITNSGHENKTKGDSIQNEKNPNPIESLEKESAFKTKAEPISSSISNMELELNI
HNSKAPKKNRLRRKSSTRHIHALELVVSRNLSPPNCTELQIDSCSSSEEIKKKKYNQMPVRHSRNLQLMEGKEPATGAKKSNKPNEQTSKRHDSDTFPEL
KLTNAPGSFTKCSNTSELKEFVNPSLPREEKEEKLETVKVSNNAEDPKDLMLSGERVLQTERSVESSSISLVPGTDYGTQESISLLEVSTLGKAKTEPNK
CVSQCAAFENPKGLIHGCSKDNRNDTEGFKYPLGHEVNHSRETSIEMEESELDAQYLQNTFKVSKRQSFAPFSNPGNAEEECATFSAHSGSLKKQSPKVT
FECEQKEENQGKNESNIKPVQTVNITAGFPVVGQKDKPVDNAKCSIKGGSRFCLSSQFRGNETGLITPNKHGLLQNPYRIPPLFPIKSFVKTKCKKNLLE
ENFEEHSMSPEREMGNENIPSTVSTISRNNIRENVFKEASSSNINEVGSSTNEVGSSINEIGSSDENIQAELGRNRGPKLNAMLRLGVLQPEVYKQSLPG
SNCKHPEIKKQEYEEVVQTVNTDFSPYLISDNLEQPMGSSHASQVCSETPDDLLDDGEIKEDTSFAENDIKESSAVFSKSVQKGELSRSPSPFTHTHLAQ
GYRRGAKKLESSEENLSSEDEELPCFQHLLFGKVNNIPSQSTRHSTVATECLSKNTEENLLSLKNSLNDCSNQVILAKASQEHHLSEETKCSASLFSSQC
SELEDLTANTNTQDPFLIGSSKQMRHQSESQGVGLSDKELVSDDEERGTGLEENNQEEQSMDSNLGEAASGCESETSVSEDCSGLSSQSDILTTQQRDTM
QHNLIKLQQEMAELEAVLEQHGSQPSNSYPSIISDSSALEDLRNPEQSTSEKAVLTSQKSSEYPISQNPEGLSADKFEVSADSSTSKNKEPGVERSSPSK
CPSLDDRWYMHSCSGSLQNRNYPSQEELIKVVDVEEQQLEESGPHDLTETSYLPRQDLEGTPYLESGISLFSDDPESDPSEDRAPESARVGNIPSSTSAL
KVPQLKVAESAQSPAAAHTTDTAGYNAMEESVSREKPELTASTERVNKRMSMVVSGLTPEEFMLVYKFARKHHITLTNLITEETTHVVMKTDAEFVCERT
LKYFLGIAGGKWVVSYFWVTQSIKERKMLNEHDFEVRGDVVNGRNHQGPKRARESQDRKIFRGLEICCYGPFTNMPTDQLEWMVQLCGASVVKELSSFTL
GTGVHPIVVVQPDAWTEDNGFHAIGQMCEAPVVTREWVLDSVALYQCQELDTYLIPQIPHSHY


DME EC Prediction for this protein is: 6.3.2
Check another protein