Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
DSTFTVLKRYQ2.7.11.24;Mitogen-activated protein kinase. 17 -
PIGSGAQGIVC2.7.11.24;Mitogen-activated protein kinase. 31
  • Domain: Protein kinase
KKLSRPFQ2.7.11.24;Mitogen-activated protein kinase. 55
  • Binding Site K=Lysine at location 55 on the protein
  • Binding site description: ATP (By similarity).
  • Domain: Protein kinase
AKRAYRE2.7.11.24;Mitogen-activated protein kinase. 67
  • Domain: Protein kinase
VNHKNII2.7.11.24;Mitogen-activated protein kinase. 80
  • Domain: Protein kinase
LLNVFTPQK2.7.11.24;Mitogen-activated protein kinase. 88
  • Domain: Protein kinase
LEEFQDVY2.7.11.24;Mitogen-activated protein kinase. 98
  • Domain: Protein kinase
VMELMDANLC2.7.11.24;Mitogen-activated protein kinase. 107
  • Domain: Protein kinase
SYLLYQMLCG2.7.11.24;Mitogen-activated protein kinase. 129
  • Domain: Protein kinase
HSAGIIHRDLKPSN2.7.11.24;Mitogen-activated protein kinase. 143
  • Active Site D=Aspartic acid at location 151 on the protein
  • Active Site Description: Proton acceptor (By similarity
  • Domain: Protein kinase
LKILDFGLAR2.7.11.24;Mitogen-activated protein kinase. 165
  • Active Site D=Aspartic acid at location 169 on the protein
  • Active Site Description: Proton acceptor (By similarity
  • Domain: Protein kinase
ILDFGLA2.7.11;Protein-serine/threonine kinases. 167
  • Active Site D=Aspartic acid at location 169 on the protein
  • Active Site Description: Proton acceptor (By similarity
  • Domain: Protein kinase
LDFGLAR2.7.11;Protein-serine/threonine kinases. 168
  • Active Site D=Aspartic acid at location 169 on the protein
  • Active Site Description: Proton acceptor (By similarity
  • Domain: Protein kinase
MTPYVVTRYYRAPEVI2.7.11.24;Mitogen-activated protein kinase. 182
  • Domain: Protein kinase
VGCIMGE2.7.11;Protein-serine/threonine kinases. 211
  • Domain: Protein kinase
IDQWNKV2.7.11.24;Mitogen-activated protein kinase. 231
  • Domain: Protein kinase
EFMKKLQPTVR2.7.11.24;Mitogen-activated protein kinase. 247
  • Domain: Protein kinase
YVENRPKY2.7.11.24;Mitogen-activated protein kinase. 259
  • Domain: Protein kinase
QARDLLS2.7.11.24;Mitogen-activated protein kinase. 293
  • Domain: Protein kinase
RDLLSKML2.7.11.24;Mitogen-activated protein kinase. 295
  • Domain: Protein kinase
LLSKMLV2.7.11;Protein-serine/threonine kinases. 297
  • Domain: Protein kinase
LLSKMLVID2.7.11.24;Mitogen-activated protein kinase. 297
  • Domain: Protein kinase
RISVDEAL2.7.11.24;Mitogen-activated protein kinase. 309
  • Domain: Protein kinase
YINVWYD2.7.11.24;Mitogen-activated protein kinase. 320
  • Domain: Protein kinase
DKQLDEREH2.7.11.24;Mitogen-activated protein kinase. 339 -
KELIYKE2.7.11.24;Mitogen-activated protein kinase. 353 -
KNGVIRGQP2.7.11.24;Mitogen-activated protein kinase. 368 -

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MSRSKRDNNFYSVEIGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAILERNVAIKKLSRPFQNQTHAKRAYRELVLMKCVNHKNIIGLLNVFTPQKSLEE
FQDVY
IVMELMDANLCQVIQMELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSFMMTPYVVTRYYRAPEVILGM
GYKENVDLWS
VGCIMGEMVCHKILFPGRDYIDQWNKVIEQLGTPCPEFMKKLQPTVRTYVENRPKYAGYSFEKLFPDVLFPADSEHNKLKASQARDLLSK
MLVID
ASKRISVDEALQHPYINVWYDPSEAEAPPPKIPDKQLDEREHTIEEWKELIYKEVMDLEERTKNGVIRGQPSPLGAAVINGSQHPSSSSSVNDVS
SMSTDPTLASDTDSSLEAAAGPLGCCR



DME EC Prediction for this protein is: 2.7.11.24
Check another protein