Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
TLVQKLHDFLAHSSEESEET3.6.1;In phosphorous-containing anhydrides. 13
  • Gene: ATRX
NSDMMEN3.6.1;In phosphorous-containing anhydrides. 53
  • Gene: ATRX
SSGSSRSKRKPSIVTKYVESDDEKP3.6.1;In phosphorous-containing anhydrides. 73
  • Gene: ATRX
ENSENDITMQSLPKGTVIVQPEPVLNEDKDDFKGPEFRSR3.6.1;In phosphorous-containing anhydrides. 110
  • Gene: ATRX
CTACGQQVN3.6.1;In phosphorous-containing anhydrides. 171 -
FQKDSIYRHP3.6.1;In phosphorous-containing anhydrides. 181 -
KYYMSDDISRD3.6.1;In phosphorous-containing anhydrides. 202
  • Gene: ATRX
RWCAEGGNLICCD3.6.1;In phosphorous-containing anhydrides. 221 -
CHNAFCKKCI3.6.1;In phosphorous-containing anhydrides. 235 -
RNLGRKE3.6.1;In phosphorous-containing anhydrides. 246 -
QWYCYIC3.6.1;In phosphorous-containing anhydrides. 262
  • Gene: ATRX
PEPLLDLVTAC3.6.1;In phosphorous-containing anhydrides. 270
  • Gene: ATRX
NLEQLLQQNKKKIKV3.6.1;In phosphorous-containing anhydrides. 286
  • Gene: ATRX
SGSVTYS3.6.1;In phosphorous-containing anhydrides. 336
  • Gene: ATRX
TKLRQLKAFKSVL3.6.1;In phosphorous-containing anhydrides. 387
  • Gene: ATRX
DIKKAHLALEEDLNSE3.6.1;In phosphorous-containing anhydrides. 401
  • Gene: ATRX
EPANTSE3.6.1;In phosphorous-containing anhydrides. 505
  • Gene: ATRX
EDLDMDIVSVPSSVPEDIF3.6.1;In phosphorous-containing anhydrides. 511
  • Gene: ATRX
AMEVQSS3.6.1;In phosphorous-containing anhydrides. 535
  • Gene: ATRX
RKKDKRNS3.6.1;In phosphorous-containing anhydrides. 696
  • Gene: ATRX
DQNSDSDEMLA3.6.1;In phosphorous-containing anhydrides. 726
  • Gene: ATRX
HSSSSDTDINE3.6.1;In phosphorous-containing anhydrides. 746
  • Gene: ATRX
STSGSDFDTKKGKS3.6.1;In phosphorous-containing anhydrides. 784
  • Gene: ATRX
SIISKKKRQ3.6.1;In phosphorous-containing anhydrides. 801
  • Gene: ATRX
SESSNYDSELE3.6.1;In phosphorous-containing anhydrides. 812
  • Gene: ATRX
YESSSDGTEKLPE3.6.1;In phosphorous-containing anhydrides. 1009
  • Gene: ATRX
SCDSSEDKK3.6.1;In phosphorous-containing anhydrides. 1073
  • Gene: ATRX
SSKRNTKE3.6.1;In phosphorous-containing anhydrides. 1141
  • Gene: ATRX
KEKKRNSLR3.6.1;In phosphorous-containing anhydrides. 1182
  • Gene: ATRX
TKRKQADITSSSS3.6.1;In phosphorous-containing anhydrides. 1193
  • Gene: ATRX
SSDEQKIKPVTENLVL3.6.1;In phosphorous-containing anhydrides. 1220
  • Gene: ATRX
SHTGFCQSSGDEA3.6.1;In phosphorous-containing anhydrides. 1237
  • Gene: ATRX
TVDDDDDDNDPENRIAKKMLLEEIKANLSSDEDGSSDDE3.6.1;In phosphorous-containing anhydrides. 1257
  • Gene: ATRX
NQVNSESDSDSEESKKPRYRHRLLRHKL3.6.1;In phosphorous-containing anhydrides. 1318
  • Gene: ATRX
SDGESGEEK3.6.1;In phosphorous-containing anhydrides. 1348
  • Gene: ATRX
TKPKEHKE3.6.1;In phosphorous-containing anhydrides. 1358
  • Gene: ATRX
KGRNRRKVSSEDSED3.6.1;In phosphorous-containing anhydrides. 1367
  • Gene: ATRX
DFQESGVSEEVSESEDEQRPRTRSAKKAELEENQRSYKQK3.6.1;In phosphorous-containing anhydrides. 1383
  • Gene: ATRX
EEDENDDSKSPGKGRKKIRKILKDDKLRTETQNALKEEEE3.6.1;In phosphorous-containing anhydrides. 1463
  • Gene: ATRX
KLKPHQV3.6.1;In phosphorous-containing anhydrides. 1559
  • Gene: ATRX
MGLGKTL3.6.1;In phosphorous-containing anhydrides. 1596
  • Domain: Helicase ATP-binding
EKLEVSELATVKRPQERSYMLQRWQEDGGVMIIGYEMYRN3.6.1;In phosphorous-containing anhydrides. 1649
  • Domain: Helicase ATP-binding
  • Gene: ATRX
ALVDPGPD3.6.1;In phosphorous-containing anhydrides. 1707
  • Domain: Helicase ATP-binding
  • Gene: ATRX
VVCDEGH3.6.1;In phosphorous-containing anhydrides. 1716
  • Domain: Helicase ATP-binding
  • Gene: ATRX
TGTPLQN3.6.1;In phosphorous-containing anhydrides. 1747
  • Domain: Helicase ATP-binding
EYHCMVNF3.6.1;In phosphorous-containing anhydrides. 1757
  • Domain: Helicase ATP-binding
  • Gene: ATRX
LPPKHEYV3.6.1;In phosphorous-containing anhydrides. 1827
  • Gene: ATRX
IQCKLYQYYLDHLTGVGN3.6.1;In phosphorous-containing anhydrides. 1842
  • Gene: ATRX
EGGRGKAGAKLFQDFQMLSRIWTHPWCLQLDYISKENKGY3.6.1;In phosphorous-containing anhydrides. 1862
  • Gene: ATRX
KGKKGKKDSSSSGSGSDNDVEVIKVWNSRSRGGG3.6.1;In phosphorous-containing anhydrides. 1933
  • Gene: ATRX
TGNNPSVSLKL3.6.1;In phosphorous-containing anhydrides. 1973
  • Gene: ATRX
SNPSSPAPDWYKDFVTD3.6.1;In phosphorous-containing anhydrides. 1992
  • Gene: ATRX
LVFSQSL3.6.1;In phosphorous-containing anhydrides. 2038
  • Domain: Helicase C-terminal
KPLIYKGEGKW3.6.1;In phosphorous-containing anhydrides. 2067
  • Domain: Helicase C-terminal
  • Gene: ATRX
AQSRKKWAEEFNDETNVRGRLFIISTKAGSLGINLVAANR3.6.1;In phosphorous-containing anhydrides. 2092
  • Domain: Helicase C-terminal
  • Gene: ATRX
LGINLVAANRV3.6.1;In phosphorous-containing anhydrides. 2122
  • Domain: Helicase C-terminal
  • Gene: ATRX
VAANRVIIFDA3.6.1;In phosphorous-containing anhydrides. 2127
  • Domain: Helicase C-terminal
  • Gene: ATRX
FDASWNP3.6.1;In phosphorous-containing anhydrides. 2135
  • Domain: Helicase C-terminal
FRVYRFGQTKPVY3.6.1;In phosphorous-containing anhydrides. 2149
  • Domain: Helicase C-terminal
  • Gene: ATRX
AWAEYEAEK3.6.1;In phosphorous-containing anhydrides. 2274
  • Gene: ATRX
SQTPYIPFNLGALSAMSNQQLEDLINQGREKVVEATNS3.6.1;In phosphorous-containing anhydrides. 2304
  • Gene: ATRX
TAVRIQPLEDIIS3.6.1;In phosphorous-containing anhydrides. 2343
  • Gene: ATRX
VWKENMNLSEAQVQALALSRQASQELDVKRREAIYNDVLT3.6.1;In phosphorous-containing anhydrides. 2357
  • Gene: ATRX
CVQRILMNRRLQQQY3.6.1;In phosphorous-containing anhydrides. 2404
  • Gene: ATRX
TYQQATL3.6.1;In phosphorous-containing anhydrides. 2427
  • Gene: ATRX
HLMMPKPPNLIM3.6.1;In phosphorous-containing anhydrides. 2435
  • Gene: ATRX
PSNYQQIDMRGMYQ3.6.1;In phosphorous-containing anhydrides. 2448
  • Gene: ATRX
VAGGMQPPPLQRAPPP3.6.1;In phosphorous-containing anhydrides. 2463
  • Gene: ATRX
RSKNPGPS3.6.1;In phosphorous-containing anhydrides. 2480
  • Gene: ATRX

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MTAEPMSESKLNTLVQKLHDFLAHSSEESEETSSPPRLAMNQNTDKISGSGSNSDMMENSKEEGTSSSEKSKSSGSSRSKRKPSIVTKYVESDDEKPLDD
ETVNEDASN
ENSENDITMQSLPKGTVIVQPEPVLNEDKDDFKGPEFRSRSKMKTENLKKRGEDGLHGIVSCTACGQQVNHFQKDSIYRHPSLQVLICKNC
F
KYYMSDDISRDSDGMDEQCRWCAEGGNLICCDFCHNAFCKKCILRNLGRKELSTIMDENNQWYCYICHPEPLLDLVTACNSVFENLEQLLQQNKKKIKV
DSEKSNKVYEHTSRFSPKKTSSNCNGEEKKLDDSCSGSVTYSYSALIVPKEMIKKAKKLIETTANMNSSYVKFLKQATDNSEISSATKLRQLKAFKSVLA
DIKKAHLALEEDLNSEFRAMDAVNKEKNTKEHKVIDAKFETKARKGEKPCALEKKDISKSEAKLSRKQVDSEHMHQNVPTEEQRTNKSTGGEHKKSDRKE
EPQY
EPANTSEDLDMDIVSVPSSVPEDIFENLETAMEVQSSVDHQGDGSSGTEQEVESSSVKLNISSKDNRGGIKSKTTAKVTKELYVKLTPVSLSNSPI
KGADCQEVPQDKDGYKSCGLNPKLEKCGLGQENSDNEHLVENEVSLLLEESDLRRSPRVKTTPLRRPTETNPVTSNSDEECNETVKEKQKLSVPV
RKKDK
RNS
SDSAIDNPKPNKLPKSKQSETVDQNSDSDEMLAILKEVSRMSHSSSSDTDINEIHTNHKTLYDLKTQAGKDDKGKRKRKSSTSGSDFDTKKGKSAKS
SIISKKKRQTQSESSNYDSELEKEIKSMSKIGAARTTKKRIPNTKDFDSSEDEKHSKKGMDNQGHKNLKTSQEGSSDDAERKQERETFSSAEGTVDKDTT
IMELRDRLPKKQQASASTDGVDKLSGKEQSFTSLEVRKVAETKEKSKHLKTKTCKKVQDGLSDIAEKFLKKDQSDETSEDDKKQSKKGTEEKKKPSDFKK
KVIKMEQQ
YESSSDGTEKLPEREEICHFPKGIKQIKNGTTDGEKKSKKIRDKTSKKKDELSDYAEKSTGKGDSCDSSEDKKSKNGAYGREKKRCKLLGKS
SRKRQDCSSSDTEKYSMKEDGCNSSDKRLKRIELRERRNL
SSKRNTKEIQSGSSSSDAEESSEDNKKKKQRTSSKKKAVIVKEKKRNSLRTSTKRKQADI
TSSSS
SDIEDDDQNSIGEGSSDEQKIKPVTENLVLSSHTGFCQSSGDEALSKSVPVTVDDDDDDNDPENRIAKKMLLEEIKANLSSDEDGSSDDEPEEGK
KRTGKQNEENPGDEEAK
NQVNSESDSDSEESKKPRYRHRLLRHKLTVSDGESGEEKKTKPKEHKEVKGRNRRKVSSEDSEDSDFQESGVSEEVSESEDEQ
RPRTRSAKKAELEENQRSYKQK
KKRRRIKVQEDSSSENKSNSEEEEEEKEEEEEEEEEEEEEEEDENDDSKSPGKGRKKIRKILKDDKLRTETQNALKEE
EE
RRKRIAEREREREKLREVIEIEDASPTKCPITTKLVLDEDEETKEPLVQVHRNMVIKLKPHQVDGVQFMWDCCCESVKKTKKSPGSGCILAHCMGLGK
TL
QVVSFLHTVLLCDKLDFSTALVVCPLNTALNWMNEFEKWQEGLKDDEKLEVSELATVKRPQERSYMLQRWQEDGGVMIIGYEMYRNLAQGRNVKSRKL
KEIFNK
ALVDPGPDFVVCDEGHILKNEASAVSKAMNSIRSRRRIILTGTPLQNNLIEYHCMVNFIKENLLGSIKEFRNRFINPIQNGQCADSTMVDVRVM
KKRAHILYEMLAGCVQRKDYTALTKF
LPPKHEYVLAVRMTSIQCKLYQYYLDHLTGVGNNSEGGRGKAGAKLFQDFQMLSRIWTHPWCLQLDYISKENKG
Y
FDEDSMDEFIASDSDETSMSLSSDDYTKKKKKGKKGKKDSSSSGSGSDNDVEVIKVWNSRSRGGGEGNVDETGNNPSVSLKLEESKATSSSNPSSPAPD
WYKDFVTD
ADAEVLEHSGKMVLLFEILRMAEEIGDKVLVFSQSLISLDLIEDFLELASREKTEDKDKPLIYKGEGKWLRNIDYYRLDGSTTAQSRKKWAE
EFNDETNVRGRLFIISTKAGSLGINLVAANRVIIFDASWNP
SYDIQSIFRVYRFGQTKPVYVYRFLAQGTMEDKIYDRQVTKQSLSFRVVDQQQVERHFT
MNELTELYTFEPDLLDDPNSEKKKKRDTPMLPKDTILAELLQIHKEHIVGYHEHDSLLDHKEEEELTEEERKA
AWAEYEAEKKGLTMRFNIPTGTNLPPV
SFN
SQTPYIPFNLGALSAMSNQQLEDLINQGREKVVEATNSVTAVRIQPLEDIISAVWKENMNLSEAQVQALALSRQASQELDVKRREAIYNDVLTKQQM
LIS
CVQRILMNRRLQQQYNQQQQQQMTYQQATLGHLMMPKPPNLIMNPSNYQQIDMRGMYQPVAGGMQPPPLQRAPPPMRSKNPGPSQGKSM



DME EC Prediction for this protein is: 3.6.1
Check another protein