Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data

Specific Peptide	EC	Function	Location of SP in Protein	Predicted Features
ITAFNFP	1.2.1;	With NAD(+) or NADP(+) as acceptor.	191	-
LELGGNN	1.2.1;	With NAD(+) or NADP(+) as acceptor.	295	Active Site E=Glutamic acid at location 296 on the protein Active Site Description: Proton acceptor (By similarity
FAAVGTAGQRCTT	1.2.1;	With NAD(+) or NADP(+) as acceptor.	320	Active Site C=Cysteine at location 330 on the protein Active Site Description: Nucleophile (By similarity).
GSDCGIVNVN	1.2.1;	With NAD(+) or NADP(+) as acceptor.	475	-
GAEIGGAFGGEK	1.2.1;	With NAD(+) or NADP(+) as acceptor.	489	-
WKQYMRRST	1.2.1;	With NAD(+) or NADP(+) as acceptor.	513	-

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MWRLPRALCVHAAKTSKLSGPWSRPAAFMSTLLINQPQYAWLKELGLREENEGVYNGSWGGRGEVITTYCPANNEPIARVRQASVADYEETVKKAREAWK
IWADIPAPKRGEIVRQIGDALREKIQVLGSLVSLEMGKILVEGVGEVQEYVDICDYAVGLSRMIGGPILPSERSGHALIEQWNPVGLVGIITAFNFPVAV
YGWNNAIAMICGNVCLWKGAPTTSLISVAVTKIIAKVLEDNKLPGAICSLTCGGADIGTAMAKDERVNLLSFTGSTQVGKQVGLMVQERFGRSLLELGGN
NAIIAFEDADLSLVVPSALFAAVGTAGQRCTTARRLFIHESIHDEVVNRLKKAYAQIRVGNPWDPNVLYGPLHTKQAVSMFLGAVEEAKKEGGTVVYGGK
VMDRPGNYVEPTIVTGLGHDASIAHTETFAPILYVFKFKNEEEVFAWNNEVKQGLSSSIFTKDLGRIFRWLGPKGSDCGIVNVNIPTSGAEIGGAFGGEK
HTGGGRESGSDAWKQYMRRSTCTINYSKDLPLAQGIKFQ


DME EC Prediction for this protein is: 1.2.1
Check another protein