Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
PAPLSYFQNAQMSED3.4.23;Aspartic endopeptidases. 5
  • Gene: PSN1
PEPLSNGRPQG3.4.23;Aspartic endopeptidases. 47
  • Gene: PSN1
EELTLKYGA3.4.23;Aspartic endopeptidases. 71 -
VPVTLCM3.4.23;Aspartic endopeptidases. 87 -
VVVATIKSV3.4.23;Aspartic endopeptidases. 95 -
GQLIYTPFTE3.4.23;Aspartic endopeptidases. 111 -
EDTETVGQRALHS3.4.23;Aspartic endopeptidases. 120
  • Gene: PSN1
IMISVIVVMT3.4.23;Aspartic endopeptidases. 138 -
LYKYRCYK3.4.23;Aspartic endopeptidases. 153 -
LGEVFKTYNVA3.4.23;Aspartic endopeptidases. 182 -
DYITVAL3.4.23;Aspartic endopeptidases. 194
  • Gene: PSN1
WNFGVVGM3.4.23;Aspartic endopeptidases. 203 -
IHWKGPL3.4.23;Aspartic endopeptidases. 213 -
LQQAYLI3.4.23;Aspartic endopeptidases. 221 -
ALMALVFIKYLPEW3.4.23;Aspartic endopeptidases. 231 -
ISVYDLVAVL3.4.23;Aspartic endopeptidases. 253
  • Active Site D=Aspartic acid at location 257 on the protein
  • Active Site Description: By similarity.
AVLCPKGPLR3.4.23;Aspartic endopeptidases. 260 -
ETAQERN3.4.23;Aspartic endopeptidases. 273 -
FPALIYSS3.4.23;Aspartic endopeptidases. 283 -
DDGGFSEEWEAQRDS3.4.23;Aspartic endopeptidases. 332
  • Gene: PSN1
LGPHRST3.4.23;Aspartic endopeptidases. 348
  • Gene: PSN1
EERGVKLGLGDF3.4.23;Aspartic endopeptidases. 375
  • Active Site D=Aspartic acid at location 385 on the protein
  • Active Site Description: By similarity.
KLGLGDFIFYS3.4.23;Aspartic endopeptidases. 380
  • Active Site D=Aspartic acid at location 385 on the protein
  • Active Site Description: By similarity.
SGDWNTT3.4.23;Aspartic endopeptidases. 401 -
AILIGLCLTLLLLA3.4.23;Aspartic endopeptidases. 413 -
FKKALPALP3.4.23;Aspartic endopeptidases. 428 -
PFMDQLA3.4.23;Aspartic endopeptidases. 455
  • Gene: PSN1

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MTELPAPLSYFQNAQMSEDNHLSNTVRSQNDNRERQEHNDRRSLGHPEPLSNGRPQGNSRQVVEQDEEEDEELTLKYGAKHVIMLFVPVTLCMVVVVATI
KSV
SFYTRKDGQLIYTPFTEDTETVGQRALHSILNAAIMISVIVVMTILLVVLYKYRCYKVIHAWLIISSLLLLFFFSFIYLGEVFKTYNVAVDYITVAL
LIWNFGVVGMISIHWKGPLRLQQAYLIMISALMALVFIKYLPEWTAWLILAVISVYDLVAVLCPKGPLRMLVETAQERNETLFPALIYSSTMVWLVNMAE
GDPEAQRRVSKNSKYNAESTERESQDTVAEN
DDGGFSEEWEAQRDSHLGPHRSTPESRAAVQELSSSILAGEDPEERGVKLGLGDFIFYSVLVGKASATA
SGDWNTTIACFVAILIGLCLTLLLLAIFKKALPALPISITFGLVFYFATDYLVQPFMDQLAFHQFYI



DME EC Prediction for this protein is: 3.4.23
Check another protein