Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
ERTSLMSAESP3.4.23;Aspartic endopeptidases. 16
  • Gene: PSN2
EEDPDRY3.4.23;Aspartic endopeptidases. 57
  • Gene: PSN2
EELTLKYGA3.4.23;Aspartic endopeptidases. 77 -
VPVTLCM3.4.23;Aspartic endopeptidases. 93 -
VVVATIKSV3.4.23;Aspartic endopeptidases. 101 -
GQLIYTPFTE3.4.23;Aspartic endopeptidases. 117 -
IMISVIVVMT3.4.23;Aspartic endopeptidases. 144 -
LYKYRCYK3.4.23;Aspartic endopeptidases. 159 -
KTYNVAMDY3.4.23;Aspartic endopeptidases. 193 -
WNFGAVGM3.4.23;Aspartic endopeptidases. 209
  • Gene: PSN2
IHWKGPL3.4.23;Aspartic endopeptidases. 219 -
LQQAYLI3.4.23;Aspartic endopeptidases. 227 -
ALMALVFIKYLPEW3.4.23;Aspartic endopeptidases. 237 -
FIKYLPEWSAWVILGAIS3.4.23;Aspartic endopeptidases. 243
  • Gene: PSN2
ISVYDLVAVL3.4.23;Aspartic endopeptidases. 259
  • Active Site D=Aspartic acid at location 263 on the protein
  • Active Site Description: By similarity.
AVLCPKGPLR3.4.23;Aspartic endopeptidases. 266 -
ETAQERN3.4.23;Aspartic endopeptidases. 279 -
FPALIYSS3.4.23;Aspartic endopeptidases. 289 -
GEPSYPEVFE3.4.23;Aspartic endopeptidases. 332
  • Gene: PSN2
EERGVKLGLGDF3.4.23;Aspartic endopeptidases. 356
  • Active Site D=Aspartic acid at location 366 on the protein
  • Active Site Description: By similarity.
KLGLGDFIFYS3.4.23;Aspartic endopeptidases. 361
  • Active Site D=Aspartic acid at location 366 on the protein
  • Active Site Description: By similarity.
SGDWNTT3.4.23;Aspartic endopeptidases. 382 -
AILIGLCLTLLLLA3.4.23;Aspartic endopeptidases. 394 -
FKKALPALP3.4.23;Aspartic endopeptidases. 409 -

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MLTFMASDSEEEVCDERTSLMSAESPTPRSCQEGRQGPEDGENTAQWRSQENEEDGEEDPDRYVCSGVPGRPPGLEEELTLKYGAKHVIMLFVPVTLCMI
VVVATIKSVRFYTEKNGQLIYTPFTEDTPSVGQRLLNSVLNTLIMISVIVVMTIFLVVLYKYRCYKFIHGWLIMSSLMLLFLFTYIYLGEVLKTYNVAMD
Y
PTLLLTVWNFGAVGMVCIHWKGPLVLQQAYLIMISALMALVFIKYLPEWSAWVILGAISVYDLVAVLCPKGPLRMLVETAQERNEPIFPALIYSSAMVW
TVGMAKLDPSSQGALQLPYDPEMEEDSYDSF
GEPSYPEVFEPPLTGYPGEELEEEEERGVKLGLGDFIFYSVLVGKAAATGSGDWNTTLACFVAILIGLC
LTLLLLA
VFKKALPALPISITFGLIFYFSTDNLVRPFMDTLASHQLYI



DME EC Prediction for this protein is: 3.4.23
Check another protein