Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
RDLKPEN2.7.11;Protein-serine/threonine kinases. 171
  • Active Site D=Aspartic acid at location 172 on the protein
  • Active Site Description: Proton acceptor (By similarity
  • Domain: Protein kinase
KPENILLD2.7.11;Protein-serine/threonine kinases. 174
  • Domain: Protein kinase
DRDGHIK2.7.11;Protein-serine/threonine kinases. 181
  • Domain: Protein kinase
GHIKLTD2.7.11;Protein-serine/threonine kinases. 184
  • Domain: Protein kinase
IKLTDFG2.7.11;Protein-serine/threonine kinases. 186
  • Domain: Protein kinase
TDFGFAK2.7.11;Protein-serine/threonine kinases. 189
  • Domain: Protein kinase
GTPEYLAPE2.7.11;Protein-serine/threonine kinases. 206
  • Domain: Protein kinase
LGILIFE2.7.11;Protein-serine/threonine kinases. 230
  • Domain: Protein kinase

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MEAPGLAQAAAAESDSRKVAEETPDGAPALCPSPEALSPEPPVYSLQDFDTLATVGTGTFGRVHLVKEKTAKHFFALKVMSIPDVIRLKQEQHVHNEKSV
LKEVSHPFLIRLFWTWHDERFLYMLMEYVPGGELFSYLRNRGRFSSTTGLFYSAEIICAIEYLHSKEIVY
RDLKPENILLDRDGHIKLTDFGFAKKLVDR
TWTLC
GTPEYLAPEVIQSKGHGRAVDWWALGILIFEMLSGFPPFFDDNPFGIYQKILAGKIDFPRHLDFHVKDLIKKLLVVDRTRRLGNMKNGANDVKHH
RWFRSVDWEAVPQRKLKPPIVPKIAGDGDTSNFETYPENDWDTAAPVPQKDLEIFKNF



DME EC Prediction for this protein is: 2.7.11
Check another protein