Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
QVQKVDQ2.7.1.1;Hexokinase. 18
  • Gene: HXK2
LYHMRLSD2.7.1.1;Hexokinase. 26 -
MRLSDETL2.7.1.1;Hexokinase. 29 -
ATTHPTA2.7.1.1;Hexokinase. 53
  • Gene: HXK2
VKMLPTFVR2.7.1.1;Hexokinase. 61 -
ALDLGGTN2.7.1.1;Hexokinase. 82 -
LDLGGTNFRV2.7.1;Phosphotransferases with an alcohol group as acceptor. 83 -
GSGTQLFDH2.7.1.1;Hexokinase. 121 -
IKDKKLP2.7.1.1;Hexokinase. 143 -
LPLGFTFS2.7.1;Phosphotransferases with an alcohol group as acceptor. 148 -
GFTFSFP2.7.1;Phosphotransferases with an alcohol group as acceptor. 151 -
GFTFSFPC2.7.1.1;Hexokinase. 151 -
QTKLDESFLVSWTKGFKS2.7.1.1;Hexokinase. 160
  • Gene: HXK2
LIRKAIQRRGDFDIDIVA2.7.1.1;Hexokinase. 188
  • Gene: HXK2
VNDTVGTMM2.7.1.1;Hexokinase. 207 -
TMMTCGY2.7.1.1;Hexokinase. 213 -
GLIVGTG2.7.1.1;Hexokinase. 227 -
NACYMEE2.7.1;Phosphotransferases with an alcohol group as acceptor. 235 -
MCINMEWGAFGD2.7.1.1;Hexokinase. 255 -
EWGAFGD2.7.1;Phosphotransferases with an alcohol group as acceptor. 260 -
DIRTEFD2.7.1.1;Hexokinase. 272 -
SLNPGKQ2.7.1.1;Hexokinase. 285 -
GELVRLIL2.7.1.1;Hexokinase. 303 -
GKLSPELL2.7.1.1;Hexokinase. 322
  • Gene: HXK2
TGRFETKD2.7.1.1;Hexokinase. 331
  • Gene: HXK2
DPTQEDCVATHR2.7.1.1;Hexokinase. 362
  • Gene: HXK2
RICQIVS2.7.1.1;Hexokinase. 373 -
CQIVSTRSASLCAATLAAVL2.7.1.1;Hexokinase. 375
  • Gene: HXK2
RIKENKGEERLRSTIGVDGSVYKKHPHFAKRL2.7.1.1;Hexokinase. 396
  • Gene: HXK2
GVDGSVYK2.7.1;Phosphotransferases with an alcohol group as acceptor. 411 -
DGSGKGAA2.7.1.1;Hexokinase. 447 -
AMVTAVA2.7.1.1;Hexokinase. 454 -
GLSKETHA2.7.1.1;Hexokinase. 498
  • Gene: HXK2
PDGTEKG2.7.1.1;Hexokinase. 520 -
ALDLGGTN2.7.1.1;Hexokinase. 530 -
LDLGGTNFRV2.7.1;Phosphotransferases with an alcohol group as acceptor. 531 -
VEMHNKIY2.7.1.1;Hexokinase. 553
  • Binding Site K=Lysine at location 558 on the protein
  • Binding site description: ATP (Potential).
ELFDHIVQCIADFL2.7.1.1;Hexokinase. 573 -
LPLGFTFS2.7.1;Phosphotransferases with an alcohol group as acceptor. 596 -
GFTFSFP2.7.1;Phosphotransferases with an alcohol group as acceptor. 599 -
GFTFSFPC2.7.1.1;Hexokinase. 599 -
SILLKWTKGFKASGCEGEDVVTLLKEAI2.7.1.1;Hexokinase. 614
  • Gene: HXK2
VNDTVGTMM2.7.1.1;Hexokinase. 655 -
GLIVGTG2.7.1.1;Hexokinase. 675 -
NACYMEE2.7.1;Phosphotransferases with an alcohol group as acceptor. 683 -
EGRMCVN2.7.1;Phosphotransferases with an alcohol group as acceptor. 700 -
NMEWGAFGDNGC2.7.1.1;Hexokinase. 706 -
EWGAFGD2.7.1;Phosphotransferases with an alcohol group as acceptor. 708 -
AVDELSLN2.7.1.1;Hexokinase. 728
  • Gene: HXK2
SLNPGKQ2.7.1.1;Hexokinase. 733 -
SGMYLGEI2.7.1.1;Hexokinase. 746 -
YLGEIVRNILIDFTK2.7.1.1;Hexokinase. 749 -
TRGIFETKFLSQIESD2.7.1.1;Hexokinase. 778 -
HLGLESTC2.7.1.1;Hexokinase. 806
  • Gene: HXK2
RAAQLCGAG2.7.1.1;Hexokinase. 829 -
CGAGMAA2.7.1.1;Hexokinase. 834 -
VGVDGTLYKLHP2.7.1.1;Hexokinase. 858 -
DGSGKGAA2.7.1.1;Hexokinase. 895 -

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MIASHLLAYFFTELNHDQVQKVDQYLYHMRLSDETLLEISKRFRKEMEKGLGATTHPTAAVKMLPTFVRSTPDGTEHGEFLALDLGGTNFRVLWVKVTDN
GLQKVEMENQIYAIPEDIMR
GSGTQLFDHIAECLANFMDKLQIKDKKLPLGFTFSFPCHQTKLDESFLVSWTKGFKSSGVEGRDVVALIRKAIQRRGDFD
IDIVA
VVNDTVGTMMTCGYDDHNCEIGLIVGTGSNACYMEEMRHIDMVEGDEGRMCINMEWGAFGDDGSLNDIRTEFDQEIDMGSLNPGKQLFEKMISGM
YM
GELVRLILVKMAKEELLFGGKLSPELLNTGRFETKDISDIEGEKDGIRKAREVLMRLGLDPTQEDCVATHRICQIVSTRSASLCAATLAAVLQRIKEN
KGEERLRSTIGVDGSVYKKHPHFAKRL
HKTVRRLVPGCDVRFLRSEDGSGKGAAMVTAVAYRLADQHRARQKTLEHLQLSHDQLLEVKRRMKVEMERGLS
KETHA
SAPVKMLPTYVCATPDGTEKGDFLALDLGGTNFRVLLVRVRNGKWGGVEMHNKIYAIPQEVMHGTGDELFDHIVQCIADFLEYMGMKGVSLPLGF
TFSFPC
QQNSLDESILLKWTKGFKASGCEGEDVVTLLKEAIHRREEFDLDVVAVVNDTVGTMMTCGFEDPHCEVGLIVGTGSNACYMEEMRNVELVEGEE
GRMCVNMEWGAFGDNGC
LDDFRTEFDVAVDELSLNPGKQRFEKMISGMYLGEIVRNILIDFTKRGLLFRGRISERLKTRGIFETKFLSQIESDCLALLQV
RAILQ
HLGLESTCDDSIIVKEVCTVVARRAAQLCGAGMAAVVDRIRENRGLDALKVTVGVDGTLYKLHPHFAKVMHETVKDLAPKCDVSFLQSEDGSGKG
AA
LITAVACRIREAGQR



DME EC Prediction for this protein is: 2.7.1.1
Check another protein