Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
IFHEKQEG3.4.22;Cysteine endopeptidases. 4
  • Domain: Josephin
LCAQHCLNNLLQGEYFSPVEL3.4.22;Cysteine endopeptidases. 13
  • Active Site C=Cysteine at location 14 on the protein
  • Active Site Description: By similarity.
  • Domain: Josephin
NMDDSGFFSIQVISNALKVWGLELILFNSPEYQRL3.4.22;Cysteine endopeptidases. 68
  • Domain: Josephin
  • Gene: ATX3
WFNLNSLL3.4.22;Cysteine endopeptidases. 130
  • Active Site N=Asparagine at location 134 on the protein
  • Active Site Description: By similarity.
  • Domain: Josephin
GPELISDT3.4.22;Cysteine endopeptidases. 139
  • Domain: Josephin
EGYSIFVV3.4.22;Cysteine endopeptidases. 158
  • Domain: Josephin
  • Gene: ATX3
FVVKGDLPDCEADQLLQ3.4.22;Cysteine endopeptidases. 163
  • Domain: Josephin
RPKLIGEE3.4.22;Cysteine endopeptidases. 188
  • Gene: ATX3

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MESIFHEKQEGSLCAQHCLNNLLQGEYFSPVELSSIAHQLDEEERMRMAEGGVTSEDYRTFLQQPSGNMDDSGFFSIQVISNALKVWGLELILFNSPEYQ
RL
RIDPINERSFICNYKEHWFTVRKLGKQWFNLNSLLTGPELISDTYLALFLAQLQQEGYSIFVVKGDLPDCEADQLLQMIRVQQMHRPKLIGEELAQLK
EQRVHKTDLERVLEANDGSGMLDEDEEDLQRALALSRQEIDMEDEEADLRRAIQLSMQGSSRNISQDMTQTSGTNLTSEELRKRREAYFEKQQQKQQQQQ
QQQQQGDLSGQSSHPCERPATSSGALGSDLGKACSPFIMFATFTLYLTYELHVIFALHYSSFPL



DME EC Prediction for this protein is: 3.4.22
Check another protein