Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
WTCLLLCAALR2.7.10.1;Receptor protein-tyrosine kinase. 41
  • Gene: EPHA5
PKNGWEEIGEVDENYAPIHTYQVCKVMEQNQNNWLLTSWI2.7.10.1;Receptor protein-tyrosine kinase. 79
  • Gene: EPHA5
KFTLRDCNS2.7.10.1;Receptor protein-tyrosine kinase. 131 -
DTIAADE2.7.10.1;Receptor protein-tyrosine kinase. 175 -
MKLNTEVR2.7.10.1;Receptor protein-tyrosine kinase. 193 -
GFYLAFQD2.7.10.1;Receptor protein-tyrosine kinase. 209 -
LAFQDVGAC2.7.10.1;Receptor protein-tyrosine kinase. 212 -
ALVSVRV2.7.10.1;Receptor protein-tyrosine kinase. 222 -
SVRVYYKKCP2.7.10.1;Receptor protein-tyrosine kinase. 225 -
FPDTITGADSSQLLEVSG2.7.10.1;Receptor protein-tyrosine kinase. 243
  • Gene: EPHA5
EGEWLVPIGKC2.7.10.1;Receptor protein-tyrosine kinase. 279 -
CTRPPSAP2.7.10.1;Receptor protein-tyrosine kinase. 354 -
ISNVNETS2.7.10.1;Receptor protein-tyrosine kinase. 365
  • Domain: Fibronectin type-III
DTGGRKD2.7.10.1;Receptor protein-tyrosine kinase. 382
  • Domain: Fibronectin type-III
AHTNYTFE2.7.10.1;Receptor protein-tyrosine kinase. 433
  • Domain: Fibronectin type-III
NGVSDLS2.7.10.1;Receptor protein-tyrosine kinase. 445
  • Domain: Fibronectin type-III
TTNQAAPS2.7.10.1;Receptor protein-tyrosine kinase. 463 -
EPDRPNG2.7.10.1;Receptor protein-tyrosine kinase. 491
  • Domain: Fibronectin type-III
QETSYTI2.7.10.1;Receptor protein-tyrosine kinase. 511
  • Domain: Fibronectin type-III
YVFQIRA2.7.10.1;Receptor protein-tyrosine kinase. 536
  • Domain: Fibronectin type-III
RARTAAGYG2.7.10.1;Receptor protein-tyrosine kinase. 541
  • Domain: Fibronectin type-III
FSRRFEFET2.7.10.1;Receptor protein-tyrosine kinase. 551
  • Domain: Fibronectin type-III
  • Gene: EPHA5
KAKQDPEEEKM2.7.10.1;Receptor protein-tyrosine kinase. 625 -
DPHTYEDP2.7.10.1;Receptor protein-tyrosine kinase. 652 -
TYEDPNQAV2.7.10.1;Receptor protein-tyrosine kinase. 655 -
QAVHEFAKE2.7.10.1;Receptor protein-tyrosine kinase. 661 -
GAGEFGEV2.7.10.1;Receptor protein-tyrosine kinase. 682
  • Domain: Protein kinase
GRLKLPG2.7.10.1;Receptor protein-tyrosine kinase. 692
  • Domain: Protein kinase
LKLPGKR2.7.10.1;Receptor protein-tyrosine kinase. 694
  • Domain: Protein kinase
GYTEKQRRDFL2.7.10.1;Receptor protein-tyrosine kinase. 712
  • Domain: Protein kinase
EASIMGQF2.7.10.1;Receptor protein-tyrosine kinase. 724
  • Domain: Protein kinase
IMGQFDHPNII2.7.10.1;Receptor protein-tyrosine kinase. 727
  • Domain: Protein kinase
LEGVVTKS2.7.10.1;Receptor protein-tyrosine kinase. 739
  • Domain: Protein kinase
MIVTEYMENGSLD2.7.10.1;Receptor protein-tyrosine kinase. 750
  • Domain: Protein kinase
DGQFTVIQL2.7.10.1;Receptor protein-tyrosine kinase. 769
  • Domain: Protein kinase
QLVGMLRG2.7.10.1;Receptor protein-tyrosine kinase. 776
  • Domain: Protein kinase
GMKYLSDM2.7.10;Protein-tyrosine kinases. 787
  • Domain: Protein kinase
DMGYVHRDLAARNIL2.7.10.1;Receptor protein-tyrosine kinase. 793
  • Active Site D=Aspartic acid at location 800 on the protein
  • Active Site Description: Proton acceptor (By similarity
  • Domain: Protein kinase
RDLAARN2.7.10;Protein-tyrosine kinases. 799
  • Active Site D=Aspartic acid at location 800 on the protein
  • Active Site Description: Proton acceptor (By similarity
  • Domain: Protein kinase
NLVCKVSDFGLSR2.7.10.1;Receptor protein-tyrosine kinase. 811
  • Domain: Protein kinase
LEDDPEAAYTT2.7.10.1;Receptor protein-tyrosine kinase. 825
  • Domain: Protein kinase
RWTAPEAI2.7.10.1;Receptor protein-tyrosine kinase. 843
  • Domain: Protein kinase
RKFTSASD2.7.10.1;Receptor protein-tyrosine kinase. 853
  • Domain: Protein kinase
SDVWSYGI2.7.10;Protein-tyrosine kinases. 859
  • Domain: Protein kinase
SYGERPYW2.7.10.1;Receptor protein-tyrosine kinase. 873
  • Domain: Protein kinase
EEGYRLP2.7.10.1;Receptor protein-tyrosine kinase. 892
  • Domain: Protein kinase
QLMLDCW2.7.10.1;Receptor protein-tyrosine kinase. 909
  • Domain: Protein kinase
LMLDCWQK2.7.10.1;Receptor protein-tyrosine kinase. 910
  • Domain: Protein kinase
LDKLIRNP2.7.10.1;Receptor protein-tyrosine kinase. 932
  • Domain: Protein kinase

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MRGSGPRGAGRRRPPSGGGDTPITPASLAGCYSAPRRAPLWTCLLLCAALRTLLASPSNEVNLLDSRTVMGDLGWIAFPKNGWEEIGEVDENYAPIHTYQ
VCKVMEQNQNNWLLTSWI
SNEGASRIFIELKFTLRDCNSLPGGLGTCKETFNMYYFESDDQNGRNIKENQYIKIDTIAADESFTELDLGDRVMKLNTEVR
DVGPLSKKGFYLAFQDVGACIALVSVRVYYKKCPSVVRHLAVFPDTITGADSSQLLEVSGSCVNHSVTDEPPKMHCSAEGEWLVPIGKCMCKAGYEEKNG
TCQVCRPGFFKASPHIQSCGKCPPHSYTHEEASTSCVCEKDYFRRESDPPTMA
CTRPPSAPRNAISNVNETSVFLEWIPPADTGGRKDVSYYIACKKCNS
HAGVCEECGGHVRYLPRQSGLKNTSVMMVDLL
AHTNYTFEIEAVNGVSDLSPGARQYVSVNVTTNQAAPSPVTNVKKGKIAKNSISLSWQEPDRPNGIIL
EYEIKYFEKD
QETSYTIIKSKETTITAEGLKPASVYVFQIRARTAAGYGVFSRRFEFETTPVFAASSDQSQIPVIAVSVTVGVILLAVVIGVLLSGSCCE
CGCGRASSLCAVAHPSLIWRCGYS
KAKQDPEEEKMHFHNGHIKLPGVRTYIDPHTYEDPNQAVHEFAKEIEASCITIERVIGAGEFGEVCSGRLKLPGKR
ELPVAIKTLKVGYTEKQRRDFLGEASIMGQFDHPNIIHLEGVVTKSKPVMIVTEYMENGSLDTFLKKNDGQFTVIQLVGMLRGISAGMKYLSDMGYVHRD
LAARNIL
INSNLVCKVSDFGLSRVLEDDPEAAYTTRGGKIPIRWTAPEAIAFRKFTSASDVWSYGIVMWEVVSYGERPYWEMTNQDVIKAVEEGYRLPSP
MDCPAALY
QLMLDCWQKERNSRPKFDEIVNMLDKLIRNPSSLKTLVNASCRVSNLLAEHSPLGSGAYRSVGEWLEAIKMGRYTEIFMENGYSSMDAVAQV
TLEDLRRLGVTLVGHQKKIMNSLQEMKVQLVNGMVPL



DME EC Prediction for this protein is: 2.7.10.1
Check another protein