Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
GFYLAFQD2.7.10.1;Receptor protein-tyrosine kinase. 173 -
LDYEVKY2.7.10.1;Receptor protein-tyrosine kinase. 465
  • Domain: Fibronectin type-III
YIDPFTYEDPNEAV2.7.10.1;Receptor protein-tyrosine kinase. 590 -
REFAKEID2.7.10.1;Receptor protein-tyrosine kinase. 604 -
GAGEFGEV2.7.10.1;Receptor protein-tyrosine kinase. 622
  • Domain: Protein kinase
GYTERQR2.7.10.1;Receptor protein-tyrosine kinase. 652
  • Domain: Protein kinase
EASIMGQF2.7.10.1;Receptor protein-tyrosine kinase. 664
  • Domain: Protein kinase
NIIRLEGV2.7.10.1;Receptor protein-tyrosine kinase. 675
  • Domain: Protein kinase
TEFMENG2.7.10;Protein-tyrosine kinases. 693
  • Domain: Protein kinase
DGQFTVIQL2.7.10.1;Receptor protein-tyrosine kinase. 709
  • Domain: Protein kinase
QLVGMLRG2.7.10.1;Receptor protein-tyrosine kinase. 716
  • Domain: Protein kinase
YVHRDLAARNILVN2.7.10.1;Receptor protein-tyrosine kinase. 736
  • Active Site D=Aspartic acid at location 740 on the protein
  • Active Site Description: Proton acceptor (By similarity
  • Domain: Protein kinase
RDLAARN2.7.10;Protein-tyrosine kinases. 739
  • Active Site D=Aspartic acid at location 740 on the protein
  • Active Site Description: Proton acceptor (By similarity
  • Domain: Protein kinase
NLVCKVSDFGLSR2.7.10.1;Receptor protein-tyrosine kinase. 751
  • Domain: Protein kinase
SDPTYTS2.7.10.1;Receptor protein-tyrosine kinase. 770
  • Domain: Protein kinase
RWTAPEAI2.7.10.1;Receptor protein-tyrosine kinase. 785
  • Domain: Protein kinase
RKFTSASD2.7.10.1;Receptor protein-tyrosine kinase. 795
  • Domain: Protein kinase
WSYGIVMWEVMS2.7.10.1;Receptor protein-tyrosine kinase. 804
  • Domain: Protein kinase
GERPYWD2.7.10.1;Receptor protein-tyrosine kinase. 817
  • Domain: Protein kinase
MSNQDVI2.7.10.1;Receptor protein-tyrosine kinase. 824
  • Domain: Protein kinase
QLMLDCW2.7.10.1;Receptor protein-tyrosine kinase. 851
  • Domain: Protein kinase
LMLDCWQK2.7.10.1;Receptor protein-tyrosine kinase. 852
  • Domain: Protein kinase
LDKMIRNP2.7.10.1;Receptor protein-tyrosine kinase. 874
  • Domain: Protein kinase
EDLLRIG2.7.10.1;Receptor protein-tyrosine kinase. 945
  • Domain: SAM
LAGHQKKIL2.7.10.1;Receptor protein-tyrosine kinase. 954
  • Domain: SAM

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MELRVLLCWASLAAALEETLLNTKLETADLKWVTFPQVDGQWEELSGLDEEQHSVRTYEVCDVQRAPGQAHWLRTGWVPRRGAVHVYATLRFTMLECLSL
PRAGRSCKETFTVFYYESDADTATALTPAWMENPYIKVDTVAAEHLTRKRPGAEATGKVNVKTLRLGPLSKA
GFYLAFQDQGACMALLSLHLFYKKCAQL
TVNLTRFPETVPRELVVPVAGSCVVDAVPAPGPSPSLYCREDGQWAEQPVTGCSCAPGFEAAEGNTKCRACAQGTFKPLSGEGSCQPCPANSHSNTIGSA
VCQCRVGYFRARTDPRGAPCTTPPSAPRSVVSRLNGSSLHLEWSAPLESGGREDLTYALRCRECRPGGSCAPCGGDLTFDPGPRDLVEPWVVVRGLRPDF
TYTFEVTALNGVSSLATGPVPFEPVNVTTDREVPPAVSDIRVTRSSPSSLSLAWAVPRAPSGAV
LDYEVKYHEKGAEGPSSVRFLKTSENRAELRGLKRG
ASYLVQVRARSEAGYGPFGQEHHSQTQLDESEGWREQLALIAGTAVVGVVLVLVVIVVAVLCLRKQSNGREAEYSDKHGQYLIGHGTKV
YIDPFTYEDPN
EAVREFAKEID
VSYVKIEEVIGAGEFGEVCRGRLKAPGKKESCVAIKTLKGGYTERQRREFLSEASIMGQFEHPNIIRLEGVVTNSMPVMILTEFMENGA
LDSFLRLN
DGQFTVIQLVGMLRGIASGMRYLAEMSYVHRDLAARNILVNSNLVCKVSDFGLSRFLEENSSDPTYTSSLGGKIPIRWTAPEAIAFRKFTSA
SD
AWSYGIVMWEVMSFGERPYWDMSNQDVINAIEQDYRLPPPPDCPTSLHQLMLDCWQKDRNARPRFPQVVSALDKMIRNPASLKIVARENGGASHPLLD
QRQPHYSAFGSVGEWLRAIKMGRYEESFAAAGFGSFELVSQISA
EDLLRIGVTLAGHQKKILASVQHMKSQAKPGTPGGTGGPAPQY



DME EC Prediction for this protein is: 2.7.10.1
Check another protein