Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
MTAAAGSA3.2.1.46;Galactosylceramidase. 17
  • Gene: GALC
SGGGATSRLLVNY3.2.1.46;Galactosylceramidase. 62
  • Gene: GALC
ILDYLFKPNFGASLHI3.2.1.46;Galactosylceramidase. 82
  • Gene: GALC
KVEIGGD3.2.1.46;Galactosylceramidase. 99
  • Gene: GALC
QTTDGTEPSHMH3.2.1.46;Galactosylceramidase. 107
  • Gene: GALC
FRGYEWWLM3.2.1.46;Galactosylceramidase. 126
  • Gene: GALC
WPYVNLQLTAYY3.2.1.46;Galactosylceramidase. 163
  • Gene: GALC
LDIDYIGIWNE3.2.1.46;Galactosylceramidase. 188
  • Gene: GALC
IIASDNLW3.2.1.46;Galactosylceramidase. 223
  • Gene: GALC
KLWSSED3.2.1.46;Galactosylceramidase. 269
  • Gene: GALC
RILNQNY3.2.1.46;Galactosylceramidase. 290
  • Gene: GALC
GLMTAQEPWSGHYVV3.2.1.46;Galactosylceramidase. 323
  • Gene: GALC
AHTTQFTQPGW3.2.1.46;Galactosylceramidase. 345
  • Gene: GALC
GGSYVALTD3.2.1.46;Galactosylceramidase. 367
  • Gene: GALC
FADQTGVFEY3.2.1.46;Galactosylceramidase. 507
  • Gene: GALC
GVFEYFTN3.2.1.46;Galactosylceramidase. 512
  • Gene: GALC
TISIIGDY3.2.1.46;Galactosylceramidase. 548
  • Gene: GALC
CDVYIETP3.2.1.46;Galactosylceramidase. 564
  • Gene: GALC
GGVFIAGRVNKGGILIRSA3.2.1.46;Galactosylceramidase. 574
  • Gene: GALC
PKNGWAAIGTHSFE3.2.1.46;Galactosylceramidase. 659
  • Gene: GALC

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MAEWLLSASWQRRAKAMTAAAGSAGRAAVPLLLCALLAPGGAYVLDDSDGLGREFDGIGAVSGGGATSRLLVNYPEPYRSQILDYLFKPNFGASLHILKV
EIGGD
GQTTDGTEPSHMHYALDENYFRGYEWWLMKEAKKRNPNITLIGLPWSFPGWLGKGFDWPYVNLQLTAYYVVTWIVGAKRYHDLDIDYIGIWNERS
YNANYIKILRKMLNYQGLQRVK
IIASDNLWESISASMLLDAELFKVVDVIGAHYPGTHSAKDAKLTGKKLWSSEDFSTLNSDMGAGCWGRILNQNYINGY
MTSTIAWNLVASYYEQLPYGRC
GLMTAQEPWSGHYVVESPVWVSAHTTQFTQPGWYYLKTVGHLEKGGSYVALTDGLGNLTIIIETMSHKHSKCIRPFLP
YFNVSQQFATFVLKGSFSEIPELQVWYTKLGKTSERFLFKQLDSLWLLDSDGSFTLSLHEDELFTLTTLTTGRKGSYPLPPKSQPFPSTYKDDFNVDYPF
FSEAPN
FADQTGVFEYFTNIEDPGEHHFTLRQVLNQRPITWAADASNTISIIGDYNWTNLTIKCDVYIETPDTGGVFIAGRVNKGGILIRSARGIFFWIF
ANGSYRVTGDLAGWIIYALGRVEVTAKKWYTLTLTIKGHFASGMLNDKSLWTDIPVNF
PKNGWAAIGTHSFEFAQFDNFLVEATR



DME EC Prediction for this protein is: 3.2.1.46
Check another protein