Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
GGFGLCGIPE2.8.3.5;3-oxoacid CoA-transferase. 62 -
SNNAGVD2.8.3.5;3-oxoacid CoA-transferase. 89 -
ELTPQGTLAERIRAGGAGVPAFYT2.8.3.5;3-oxoacid CoA-transferase. 134 -
ERIRAGG2.8.3;CoA-transferases. 143 -
PREVREF2.8.3.5;3-oxoacid CoA-transferase. 186 -
GDFALVKAWKAD2.8.3.5;3-oxoacid CoA-transferase. 205
  • Gene: SCOT1
RKSARNF2.8.3;CoA-transferases. 224 -
FAPEDIH2.8.3.5;3-oxoacid CoA-transferase. 254 -
KGEKYEKRIERLS2.8.3.5;3-oxoacid CoA-transferase. 271
  • Gene: SCOT1
RIIKRAALEF2.8.3.5;3-oxoacid CoA-transferase. 304 -
RAALEFEDGMY2.8.3.5;3-oxoacid CoA-transferase. 308 -
DGMYANLGIGIP2.8.3.5;3-oxoacid CoA-transferase. 315 -
DADLINAGK2.8.3.5;3-oxoacid CoA-transferase. 360 -
DLINAGK2.8.3;CoA-transferases. 362 -
SFAMIRG2.8.3.5;3-oxoacid CoA-transferase. 385 -
GDLANWM2.8.3.5;3-oxoacid CoA-transferase. 408 -
VKGMGGAMDLV2.8.3.5;3-oxoacid CoA-transferase. 420 -
VVVTMEH2.8.3.5;3-oxoacid CoA-transferase. 437 -
KIMEKCT2.8.3.5;3-oxoacid CoA-transferase. 451 -

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MAALKLLSSGLRLCASARGSGATWYKGCVCSFSTSAHRHTKFYTDPVEAVKDIPDGATVLVGGFGLCGIPENLIDALLKTGVKGLTAVSNNAGVDNFGLG
LLLRSKQIKRMVSSYVGENAEFERQYLSGELEV
ELTPQGTLAERIRAGGAGVPAFYTPTGYGTLVQEGGSPIKYNKDGSVAIASKPREVREFNGQHFILE
EAIT
GDFALVKAWKADRAGNVIFRKSARNFNLPMCKAAETTVVEVEEIVDIGAFAPEDIHIPQIYVHRLIKGEKYEKRIERLSIRKEGDGEAKSAKPGDD
VRE
RIIKRAALEFEDGMYANLGIGIPLLASNFISPNITVHLQSENGVLGLGPYPRQHEADADLINAGKETVTILPGASFFSSDESFAMIRGGHVDLTMLG
AMQVSKY
GDLANWMIPGKMVKGMGGAMDLVSSAKTKVVVTMEHSAKGNAHKIMEKCTLPLTGKQCVNRIITEKAVFDVDKKKGLTLIELWEGLTVDDVQK
STGCDFAVSPKLMPMQQIAN



DME EC Prediction for this protein is: 2.8.3.5
Check another protein