Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
DSCQGDSGG3.4.21;Serine endopeptidases. 395
  • Active Site S=Serine at location 401 on the protein
  • Active Site Description: Charge relay system (By simila
  • Binding Site S=Serine at location 401 on the protein
  • Binding site description: Substrate.
  • Domain: Peptidase S1
CQGDSGGP3.4.21;Serine endopeptidases. 397
  • Active Site S=Serine at location 401 on the protein
  • Active Site Description: Charge relay system (By simila
  • Binding Site S=Serine at location 401 on the protein
  • Binding site description: Substrate.
  • Domain: Peptidase S1
GDSGGPL3.4.21;Serine endopeptidases. 399
  • Active Site S=Serine at location 401 on the protein
  • Active Site Description: Charge relay system (By simila
  • Domain: Peptidase S1
SGGPLVC3.4.21;Serine endopeptidases. 401
  • Active Site S=Serine at location 401 on the protein
  • Active Site Description: Charge relay system (By simila
  • Domain: Peptidase S1

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MGENDPPAVEAPFSFRSLFGLDDLKISPVAPDADAVAAQILSLLPLKFFPIIVIGIIALILALAIGLGIHFDCSGKYRCRSSFKCIELIARCDGVSDCKD
GEDEYRCVRVGGQNAVLQVFTAASWKTMCSDDWKGHYANVACAQLGFPSYVSSDNLRVSSLEGQFREEFVSIDHLLPDDKVTALHHSVYVREGCASGHVV
TLQCTACGHRRGYSSRIVGGNMSLLSQWPWQASLQFQGYHLCGGSVITPLWIITAAHCVYDLYLPKSWTIQVGLVSLLDNPAPSHLVEKIVYHSKYKPKR
LGNDIALMKLAGPLTFNEMIQPVCLPNSEENFPDGKVCWTSGWGATEDGAGDASPVLNHAAVPLISNKICNHRDVYGGIISPSMLCAGYLTGGV
DSCQGD
SGGPLVC
QERRLWKLVGATSFGIGCAEVNKPGVYTRVTSFLDWIHEQMERDLKT



DME EC Prediction for this protein is: 3.4.21
Check another protein