Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
IHILYLPE3.4.21;Serine endopeptidases. 310
  • Gene: RELN
WALDNIL3.4.21;Serine endopeptidases. 343
  • Gene: RELN
EEFESQP3.4.21;Serine endopeptidases. 422
  • Gene: RELN
HMIQFSINLGCGT3.4.21;Serine endopeptidases. 570
  • Gene: RELN
YIGPSCLKFCSGRGQCTR3.4.21;Serine endopeptidases. 669
  • Gene: RELN
GCKCDPGFSGPACE3.4.21;Serine endopeptidases. 688
  • Domain: EGF-like
  • Gene: RELN
ASQTFPMFISESF3.4.21;Serine endopeptidases. 703
  • Gene: RELN
FLDSSQSRFLQFTLRLGSKSVLSTC3.4.21;Serine endopeptidases. 761
  • Gene: RELN
YHEPRIISVELP3.4.21;Serine endopeptidases. 818
  • Gene: RELN
EDVWAIDEI3.4.21;Serine endopeptidases. 851
  • Gene: RELN
MTSVLFNSISLDFTNLVEVTQSLGFYLGN3.4.21;Serine endopeptidases. 861
  • Gene: RELN
SSMRYVETQSMQIGASYMIQF3.4.21;Serine endopeptidases. 910
  • Gene: RELN
LVMGCGQK3.4.21;Serine endopeptidases. 932
  • Gene: RELN
EFTQWRR3.4.21;Serine endopeptidases. 987
  • Gene: RELN
KAGKRQLVSWDLDT3.4.21;Serine endopeptidases. 1111
  • Gene: RELN
WVDFVQFYIQIGGES3.4.21;Serine endopeptidases. 1126
  • Gene: RELN
DDIIILSEKQK3.4.21;Serine endopeptidases. 1215
  • Gene: RELN
APVLLQYSHDAG3.4.21;Serine endopeptidases. 1317
  • Gene: RELN
TRFRWIQ3.4.21;Serine endopeptidases. 1384
  • Gene: RELN
VPPFGLDGVYISEPCP3.4.21;Serine endopeptidases. 1398
  • Gene: RELN
SGVCFCDLGYTA3.4.21;Serine endopeptidases. 1424
  • Domain: EGF-like
  • Gene: RELN
WYRIQGGQVDIDCLSMDTAL3.4.21;Serine endopeptidases. 1620
  • Gene: RELN
PRYAETWDFHVS3.4.21;Serine endopeptidases. 1648
  • Gene: RELN
TRFRWIQ3.4.21;Serine endopeptidases. 1741
  • Gene: RELN
LKDDFNGNLHPDLWPEVYGAERGNLNG3.4.21;Serine endopeptidases. 1804
  • Gene: RELN
LIFKGEGLRML3.4.21;Serine endopeptidases. 1839
  • Gene: RELN
SRDLDCTNT3.4.21;Serine endopeptidases. 1851
  • Gene: RELN
NATRFRLWQPYN3.4.21;Serine endopeptidases. 1920
  • Gene: RELN
LLDTFDFGP3.4.21;Serine endopeptidases. 1957
  • Gene: RELN
TDSSSADPV3.4.21;Serine endopeptidases. 2031
  • Gene: RELN
GATWHLLLPLCY3.4.21;Serine endopeptidases. 2048
  • Gene: RELN
SSLCSTEHHPSSTYY3.4.21;Serine endopeptidases. 2066
  • Metal Site H=Histidine at location 2073 on the protein
  • Metal Site Description: Zinc 1 (By similarity).
  • Gene: RELN
HFGKLHLCG3.4.21;Serine endopeptidases. 2093
  • Gene: RELN
CICDPGYSGP3.4.21;Serine endopeptidases. 2148
  • Domain: EGF-like
  • Gene: RELN
LKDDFEGQLESDRFLL3.4.21;Serine endopeptidases. 2169
  • Metal Site E=Glutamic acid at location 2178 on the protein
  • Metal Site Description: Zinc 1 (By similarity).
  • Gene: RELN
SGGKPSRKCGI3.4.21;Serine endopeptidases. 2186
  • Gene: RELN
GNNLFFNE3.4.21;Serine endopeptidases. 2200
  • Gene: RELN
ARFVQFFMRLGCGKGVPDPRSQ3.4.21;Serine endopeptidases. 2223
  • Gene: RELN
STRLRWWQPSENGHFYSPWVIDQILIGGNISG3.4.21;Serine endopeptidases. 2288
  • Gene: RELN
VNEDSFLQIDFAASCSVT3.4.21;Serine endopeptidases. 2372
  • Gene: RELN
SCYAIELEYSVDLG3.4.21;Serine endopeptidases. 2391
  • Metal Site E=Glutamic acid at location 2396 on the protein
  • Metal Site Description: Zinc 2 (By similarity).
  • Gene: RELN
RDCLPTNVEC3.4.21;Serine endopeptidases. 2412
  • Gene: RELN
RYHLQRIL3.4.21;Serine endopeptidases. 2423
  • Gene: RELN
LPTQLKDNFNR3.4.21;Serine endopeptidases. 2514
  • Gene: RELN
YSVNGGITW3.4.21;Serine endopeptidases. 2598
  • Gene: RELN
LMEIFYDQ3.4.21;Serine endopeptidases. 2609
  • Gene: RELN
SKPGFVNILLP3.4.21;Serine endopeptidases. 2618
  • Gene: RELN
HDGLDQNDWAIDNVLISGS3.4.21;Serine endopeptidases. 2645
  • Gene: RELN
DQRTVMLDTFSSAP3.4.21;Serine endopeptidases. 2665
  • Gene: RELN
PQHERSPADAGP3.4.21;Serine endopeptidases. 2680
  • Gene: RELN
ERFCDSPDGVM3.4.21;Serine endopeptidases. 2720
  • Gene: RELN
PVRFRFYQKYSD3.4.21;Serine endopeptidases. 2831
  • Gene: RELN
CICDPGYSGP3.4.21;Serine endopeptidases. 2871
  • Domain: EGF-like
  • Gene: RELN
EEIKPDLWMSLEGG3.4.21;Serine endopeptidases. 2899
  • Gene: RELN
ALTNTTRLRWWQPF3.4.21;Serine endopeptidases. 3012
  • Gene: RELN
WALDNIL3.4.21;Serine endopeptidases. 3041
  • Gene: RELN
YPNAVRTAGFCGNPSFHLYWPNKKKDKTHN3.4.21;Serine endopeptidases. 3076
  • Gene: RELN
LSSRELIIQPGYMMQFKIVVGCEA3.4.21;Serine endopeptidases. 3107
  • Gene: RELN
SCGDLHSVMLEYTKDAR3.4.21;Serine endopeptidases. 3132
  • Gene: RELN
DSWQLVQT3.4.21;Serine endopeptidases. 3150
  • Gene: RELN
RITIQLPDHVSSSATQFRWIQKGEE3.4.21;Serine endopeptidases. 3190
  • Gene: RELN
GCGQLAPYAHGDSLYFNGCQ3.4.21;Serine endopeptidases. 3294
  • Gene: RELN
TKPLDLTRASKIMFVLQIGS3.4.21;Serine endopeptidases. 3319
  • Gene: RELN
VIAQHQPKDF3.4.21;Serine endopeptidases. 3373
  • Gene: RELN
QAQRVSYNVPLEARMKGVLLRWWQPRHNGTGHDQWALDHV3.4.21;Serine endopeptidases. 3384
  • Gene: RELN

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MERSGWARQTFLLALLLGATLRARAAAGYYPRFSPFFFLCTHHGELEGDGEQGEVLISLHIAGNPTYYVPGQEYHVTISTSTFFDGLLVTGLYTSTSVQA
SQSIGGSSAFGFGIMSDHQFGNQFMCSVVASHVSHLPTTNLSFIWIAPPAGTGCVNFMATATHRGQVIFKDALAQQLCEQGAPTDVTVHPHLAEIHSDSI
ILRDDFDSYHQLQLNPNIWVECNNCETGEQCGAIMHGNAVTFCEPYGPRELITTGLNTTTASVLQFSIGSGSCRFSYSDPSIIVLYAKNNSADWIQLEKI
RAPSNVSTI
IHILYLPEDAKGENVQFQWKQENLRVGEVYEACWALDNILIINSAHRQVVLEDSLDPVDTGNWLFFPGATVKHSCQSDGNSIYFHGNEGSE
FNFATTRDVDLSTEDIQEQWS
EEFESQPTGWDVLGAVIGTECGTIESGLSMVFLKDGERKLCTPSMDTTGYGNLRFYFVMGGICDPGNSHENDIILYAKI
EGRKEHITLDTLSYSSYKVPSLVSVVINPELQTPATKFCLRQKNHQGHNRNVWAVDFFHVLPVLPSTMS
HMIQFSINLGCGTHQPGNSVSLEFSTNHGRS
WSLLHTECLPEICAGPHLPHSTVYSSENYSGWNRITIPLPNAALTRNTRIRWRQTGPILGNMWAIDNV
YIGPSCLKFCSGRGQCTRHGCKCDPGFSGPAC
E
MASQTFPMFISESFGSSRLSSYHNFYSIRGAEVSFGCGVLASGKALVFNKDGRRQLITSFLDSSQSRFLQFTLRLGSKSVLSTCRAPDQPGEGVLLHYS
YDNGITWKLLEHYSYLS
YHEPRIISVELPGDAKQFGIQFRWWQPYHSSQREDVWAIDEIIMTSVLFNSISLDFTNLVEVTQSLGFYLGNVQPYCGHDWTL
CFTGDSKLA
SSMRYVETQSMQIGASYMIQFSLVMGCGQKYTPHMDNQVKLEYSTNHGLTWHLVQEECLPSMPSCQEFTSASIYHASEFTQWRRVIVLLPQ
KTWSSATRFRWSQSYYTAQDEWALDSIYIGQQCPNMCSGHGSCDHGICRCDQGYQGTECHPEAALPSTIMSDFENQNGWESDWQEVIGGEIVKPEQGCGV
ISSGSSLYFS
KAGKRQLVSWDLDTSWVDFVQFYIQIGGESASCNKPDSREEGVLLQYSNNGGIQWHLLAEMYFSDFSKPRFVYLELPAAAKTPCTRFRWW
QPVFSGEDYDQWAV
DDIIILSEKQKQIIPVINPTLPQNFYEKPAFDYPMNQMSVWLMLANEGMVKNETFCAATPSAMIFGKSDGDRFAVTRDLTLKPGYV
LQFKLNIGCANQFSST
APVLLQYSHDAGMSWFLVKEGCYPASAGKGCEGNSRELSEPTMYHTGDFEEWTRITIVIPRSLASSKTRFRWIQESSSQKNVPP
FGLDGVYISEPCP
SYCSGHGDCISGVCFCDLGYTAAQGTCVSNVPNHNEMFDRFEGKLSPLWYKITGAQVGTGCGTLNDGKSLYFNGPGKREARTVPLDT
RNIRLVQFYIQIGSKTSGITCIKPRTRNEGLIVQYSNDNGILWHLLRELDFMSFLEPQIISIDLPQDAKTPATAFRWWQPQHGKHSAQWALDDVLIGMND
SSQTGFQDKFDGSIDLQAN
WYRIQGGQVDIDCLSMDTALIFTENIGKPRYAETWDFHVSASTFLQFEMSMGCSKPFSNSHSVQLQYSLNNGKDWHLVTEE
CVPPTIGCLHYTESSIYTSERFQNWKRITVYLPLSTISPR
TRFRWIQANYTVGADSWAIDNVVLASGCPWMCSGRGICDAGRCVCDRGFGGPYCVPVVPL
PSI
LKDDFNGNLHPDLWPEVYGAERGNLNGETIKSGTSLIFKGEGLRMLISRDLDCTNTMYVQFSLRFIAKSTPERSHSILLQFSISGGITWHLMDEFYF
PQTTNILFINVPLPYTAQT
NATRFRLWQPYNNGKKEEIWIVDDFIIDGNNVNNPVMLLDTFDFGPREDNWFFYPGGNIGLYCPYSSKGAPEEDSAMVFVS
NEVGEHSITTRDLNVNENTIIQFEINVGCS
TDSSSADPVRLEFSRDFGATWHLLLPLCYHSSSHVSSLCSTEHHPSSTYYAGTMQGWRREVVHFGKLHLC
G
SVRFRWYQGFYPAGSQPVTWAIDNVYIGPQCEEMCNGQGSCINGTKCICDPGYSGPTCKISTKNPDFLKDDFEGQLESDRFLLMSGGKPSRKCGILSSG
NNLFFNE
DGLRMLMTRDLDLSHARFVQFFMRLGCGKGVPDPRSQPVLLQYSLNGGLSWSLLQEFLFSNSSNVGRYIALEIPLKARSGSTRLRWWQPSENG
HFYSPWVIDQILIGGNISG
NTVLEDDFTTLDSRKWLLHPGGTKMPVCGSTGDALVFIEKASTRYVVSTDVAVNEDSFLQIDFAASCSVTDSCYAIELEYS
VDLG
LSWHPLVRDCLPTNVECSRYHLQRILVSDTFNKWTRITLPLPPYTRSQATRFRWHQPAPFDKQQTWAIDNVYIGDGCIDMCSGHGRCIQGNCVCDE
QWGGLYCDDPETS
LPTQLKDNFNRAPSSQNWLTVNGGKLSTVCGAVASGMALHFSGGCSRLLVTVDLNLTNAEFIQFYFMYGCLITPNNRNQGVLLEYSV
NGGITW
NLLMEIFYDQYSKPGFVNILLPPDAKEIATRFRWWQPRHDGLDQNDWAIDNVLISGSADQRTVMLDTFSSAPVPQHERSPADAGPVGRIAFDMF
MEDKTSVNEHWLFHDDCTV
ERFCDSPDGVMLCGSHDGREVYAVTHDLTPTEGWIMQFKISVGCKVSEKIAQNQIHVQYSTDFGVSWNYLVPQCLPADPKC
SGSVSQPSVFFPTKGWKRITYPLPESLVGN
PVRFRFYQKYSDMQWAIDNFYLGPGCLDNCRGHGDCLREQCICDPGYSGPNCYLTHTLKTFLKERFDSEE
IKPDLWMSLEGG
STCTECGILAEDTALYFGGSTVRQAVTQDLDLRGAKFLQYWGRIGSENNMTSCHRPICRKEGVLLDYSTDGGITWTLLHEMDYQKYIS
VRHDYILLPED
ALTNTTRLRWWQPFVISNGIVVSGVERAQWALDNILIGGAEINPSQLVDTFDDEGTSHEENWSFYPNAVRTAGFCGNPSFHLYWPNKKK
DKTHN
ALSSRELIIQPGYMMQFKIVVGCEATSCGDLHSVMLEYTKDARSDSWQLVQTQCLPSSSNSIGCSPFQFHEATIYNSVNSSSWKRITIQLPDHVS
SSATQFRWIQKGEE
TEKQSWAIDHVYIGEACPKLCSGHGYCTTGAICICDESFQGDDCSVFSHDLPSYIKDNFESARVTEANWETIQGGVIGSGCGQLAP
YAHGDSLYFNGCQ
IRQAATKPLDLTRASKIMFVLQIGSMSQTDSCNSDLSGPHAVDKAVLLQYSVNNGITWHVIAQHQPKDFTQAQRVSYNVPLEARMKG
VLLRWWQPRHNGTGHDQWALDHV
EVVLVSTRKQNYMMNFSRQHGLRHFYNRRRRSLRRYP



DME EC Prediction for this protein is: 3.4.21
Check another protein