Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
VARFQKIPN3.6.3.8;Calcium-transporting ATPase. 3
  • Gene: AT2C1
ENETMIPVLTSK3.6.3.8;Calcium-transporting ATPase. 13
  • Gene: AT2C1
LQADLQNGLNK3.6.3.8;Calcium-transporting ATPase. 38
  • Gene: AT2C1
QFKNPLI3.6.3.8;Calcium-transporting ATPase. 78 -
QFDDAVSITVAI3.6.3.8;Calcium-transporting ATPase. 99
  • Gene: AT2C1
PPECHCVREGKLEHTLARDLVPGDTVCLSVGDRVPADLRL3.6.3.8;Calcium-transporting ATPase. 136
  • Gene: AT2C1
GDRVPAD3.6.3;Acting on acid anhydrides; catalyzing transmembrane movement 166 -
DESSLTGE3.6.3.8;Calcium-transporting ATPase. 184 -
PCSKVTAPQPAA3.6.3.8;Calcium-transporting ATPase. 194
  • Gene: AT2C1
NIAFMGTLVR3.6.3.8;Calcium-transporting ATPase. 215 -
GVVIGTG3.6.3.8;Calcium-transporting ATPase. 230 -
FGEVFKMM3.6.3.8;Calcium-transporting ATPase. 241 -
PKTPLQKSMD3.6.3.8;Calcium-transporting ATPase. 254 -
AIPEGLP3.6.3.8;Calcium-transporting ATPase. 305
  • Metal Site I=Isoleucine at location 306 on the protein
  • Metal Site Description: Calcium 2; via carbonyl oxygen
VTVTLALGV3.6.3.8;Calcium-transporting ATPase. 314 -
IVKKLPIVETLGCC3.6.3.8;Calcium-transporting ATPase. 331 -
DKTGTLT3.6.3;Acting on acid anhydrides; catalyzing transmembrane movement 350
  • Active Site D=Aspartic acid at location 350 on the protein
  • Active Site Description: 4-aspartylphosphate intermedia
AEVTGVGYN3.6.3.8;Calcium-transporting ATPase. 373
  • Gene: AT2C1
FGEVIVDGDVVHGFYNP3.6.3.8;Calcium-transporting ATPase. 383
  • Gene: AT2C1
VSRIVEAGCVCNDAVIRNNTLMGKPTEGALIALAMKMGLD3.6.3.8;Calcium-transporting ATPase. 401
  • Gene: AT2C1
PFSSEQKWMAV3.6.3.8;Calcium-transporting ATPase. 453 -
GLRVLALA3.6.3.8;Calcium-transporting ATPase. 521 -
LSQIVPKVAVFYRASPRHKMKIIKSLQKNG3.6.3.8;Calcium-transporting ATPase. 607
  • Gene: AT2C1
VVAMTGDGVNDA3.6.3.8;Calcium-transporting ATPase. 638
  • Metal Site D=Aspartic acid at location 644 on the protein
  • Metal Site Description: Magnesium (By similarity).
MTGDGVND3.6.3;Acting on acid anhydrides; catalyzing transmembrane movement 641
  • Metal Site D=Aspartic acid at location 644 on the protein
  • Metal Site Description: Magnesium (By similarity).
ADIGVAMG3.6.3;Acting on acid anhydrides; catalyzing transmembrane movement 655 -
MILVDDDF3.6.3.8;Calcium-transporting ATPase. 675 -
NIKNFVRFQLSTSI3.6.3.8;Calcium-transporting ATPase. 698 -
PLNAMQILW3.6.3.8;Calcium-transporting ATPase. 728 -
MQILWINI3.6.3.8;Calcium-transporting ATPase. 732
  • Metal Site N=Asparagine at location 738 on the protein
  • Metal Site Description: Calcium 2 (By similarity).
RDTTMTFTCFVFFDMFNAL3.6.3.8;Calcium-transporting ATPase. 806 -
TKSVFEIG3.6.3.8;Calcium-transporting ATPase. 830 -
PPLQKVFQTE3.6.3.8;Calcium-transporting ATPase. 862 -
EIIKKVERSREK3.6.3.8;Calcium-transporting ATPase. 893
  • Gene: AT2C1

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MKVARFQKIPNGENETMIPVLTSKKASELPVSEVASILQADLQNGLNKCEVSHRRAFHGWNEFDISEDEPLWKKYISQFKNPLIMLLLASAVISVLMHQF
DDAVSITVAI
LIVVTVAFVQEYRSEKSLEELSKLVPPECHCVREGKLEHTLARDLVPGDTVCLSVGDRVPADLRLFEAVDLSIDESSLTGETTPCSKVTA
PQPAA
TNGDLASRSNIAFMGTLVRCGKAKGVVIGTGENSEFGEVFKMMQAEEAPKTPLQKSMDLLGKQLSFYSFGIIGIIMLVGWLLGKDILEMFTISVS
LAVA
AIPEGLPIVVTVTLALGVMRMVKKRAIVKKLPIVETLGCCNVICSDKTGTLTKNEMTVTHIFTSDGLHAEVTGVGYNQFGEVIVDGDVVHGFYNPA
VSRIVEAGCVCNDAVIRNNTLMGKPTEGALIALAMKMGLDGLQQDYIRKAEYPFSSEQKWMAVKCVHRTQQDRPEICFMKGAYEQVIKYCTTYQSKGQTL
TLTQQQRDVYQQEKARMGSA
GLRVLALASGPELGQLTFLGLVGIIDPPRTGVKEAVTTLIASGVSIKMITGDSQETAVAIASRLGLYSKTSQSVSGEEID
AMDVQQ
LSQIVPKVAVFYRASPRHKMKIIKSLQKNGSVVAMTGDGVNDAVALKAADIGVAMGQTGTDVCKEAADMILVDDDFQTIMSAIEEGKGIYNNIK
NFVRFQLSTSI
AALTLISLATLMNFPNPLNAMQILWINIIMDGPPAQSLGVEPVDKDVIRKPPRNWKDSILTKNLILKILVSSIIIVCGTLFVFWRELRD
NVITP
RDTTMTFTCFVFFDMFNALSSRSQTKSVFEIGLCSNRMFCYAVLGSIMGQLLVIYFPPLQKVFQTESLSILDLLFLLGLTSSVCIVAEIIKKVER
SREK
IQKHVSSTSSSFLEV



DME EC Prediction for this protein is: 3.6.3.8
Check another protein