Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data

Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
FQKVEKIGEGTYGVVYKA2.7.11.22;Cyclin-dependent kinase. 4
  • Domain: Protein kinase
IGEGTYG2.7.11;Protein-serine/threonine kinases. 10
  • Domain: Protein kinase
VALKKIR2.7.11;Protein-serine/threonine kinases. 30
  • Binding Site K=Lysine at location 33 on the protein
  • Binding site description: ATP (By similarity).
  • Domain: Protein kinase
EGVPSTA2.7.11.22;Cyclin-dependent kinase. 42
  • Domain: Protein kinase
TAIREIS2.7.11;Protein-serine/threonine kinases. 47
  • Domain: Protein kinase
KLYLVFE2.7.11.22;Cyclin-dependent kinase. 75
  • Domain: Protein kinase
FCHSHRV2.7.11.22;Cyclin-dependent kinase. 117
  • Domain: Protein kinase
VIHRDLK2.7.11;Protein-serine/threonine kinases. 123
  • Active Site D=Aspartic acid at location 127 on the protein
  • Active Site Description: Proton acceptor (By similarity
  • Domain: Protein kinase
HRDLKPQN2.7.11;Protein-serine/threonine kinases. 125
  • Active Site D=Aspartic acid at location 127 on the protein
  • Active Site Description: Proton acceptor (By similarity
  • Domain: Protein kinase
LADFGLA2.7.11;Protein-serine/threonine kinases. 143
  • Binding Site D=Aspartic acid at location 145 on the protein
  • Binding site description: ATP (By similarity).
  • Domain: Protein kinase
DFGLARA2.7.11;Protein-serine/threonine kinases. 145
  • Active Site D=Aspartic acid at location 145 on the protein
  • Active Site Description: Proton acceptor (By similarity
  • Binding Site D=Aspartic acid at location 145 on the protein
  • Binding site description: ATP (By similarity).
  • Domain: Protein kinase
DFGLARAFG2.7.11.22;Cyclin-dependent kinase. 145
  • Binding Site D=Aspartic acid at location 145 on the protein
  • Binding site description: ATP (By similarity).
  • Domain: Protein kinase
EVVTLWYRAP2.7.11.22;Cyclin-dependent kinase. 162
  • Domain: Protein kinase
VVTLWYR2.7.11;Protein-serine/threonine kinases. 163
  • Domain: Protein kinase
WSIGCIFAE2.7.11;Protein-serine/threonine kinases. 187
  • Domain: Protein kinase
GCIFAEM2.7.11;Protein-serine/threonine kinases. 190
  • Domain: Protein kinase
SEIDQLF2.7.11.22;Cyclin-dependent kinase. 207
  • Domain: Protein kinase

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MDMFQKVEKIGEGTYGVVYKAKNRETGQLVALKKIRLDLEMEGVPSTAIREISLLKELKHPNIVRLLDVVHNERKLYLVFEFLSQDLKKYMDSTPGSELP
LHLIKSYLFQLLQGVSFCHSHRVIHRDLKPQNLLINELGAIKLADFGLARAFGVPLRTYTHEVVTLWYRAPEILLGSKFYTTAVDIWSIGCIFAEMVTRK
ALFPGDSEIDQLFRIFRMLGTPSEDTWPGVTQLPDYKGSFPKWTRKGLEEIVPNLEPEGRDLLMQLLQYDPSQRITAKTALAHPYFSSPEPSPAARQYVL
QRFRH


DME EC Prediction for this protein is: 2.7.11.22
Check another protein